Recombinant Brucella melitensis biotype 2 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
plsY; BMEA_B0576; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Brucella melitensis biotype 2 (strain ATCC 23457)
Target Names
plsY
Target Protein Sequence
MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGATNVLRTGNKKL AAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWAGALVFAAAWIVTALLARYSSLSALVASLVVPIALYSRGNQALAALFAIMTVIVFI KHRANISRLLNGTESKIGAKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Glycerol-3-phosphate acyltransferase (plsY) in Brucella melitensis pathogenesis?

Glycerol-3-phosphate acyltransferase (plsY) in B. melitensis catalyzes the first committed step in phospholipid biosynthesis by transferring an acyl group to glycerol-3-phosphate to form lysophosphatidic acid. This enzymatic activity is critical for bacterial membrane integrity, which directly influences virulence and pathogenicity. Transcriptional profile studies of B. melitensis have revealed that genes involved in membrane structure and metabolism are differentially regulated during infection, suggesting plsY plays a significant role in bacterial adaptation to the host environment . The importance of membrane components in Brucella virulence is further evidenced by the BvrR/BvrS two-component system, which regulates outer membrane proteins essential for intracellular survival .

Methodological approach for functional characterization:

  • Create conditional knockdown strains using inducible promoters

  • Measure changes in phospholipid composition using LC-MS/MS

  • Assess membrane integrity using fluorescent dyes and electron microscopy

  • Evaluate impact on intracellular survival in macrophage infection models

What expression systems are optimal for producing recombinant Brucella melitensis plsY?

The selection of appropriate expression systems is critical for obtaining functional recombinant plsY protein. Based on protocols for similar bacterial membrane-associated proteins:

Expression SystemAdvantagesDisadvantagesOptimization Parameters
E. coli BL21(DE3)Rapid growth, high yield, simple geneticsMay form inclusion bodies, lack of post-translational modificationsIPTG (0.1-0.5 mM), temperature (16-30°C), induction time (4-18h)
Yeast (P. pastoris)Eukaryotic processing, secretion possibleLonger cultivation time, more complex geneticsMethanol concentration, pH, cultivation time
BaculovirusNative-like folding, high expressionComplex system, higher costMOI, harvest time, cell density
Cell-free systemsAvoids toxicity issues, rapidLower yield, higher costTemplate concentration, reaction time

For membrane proteins like plsY, E. coli expression with solubility-enhancing fusion tags (MBP, SUMO) at reduced temperatures (16-20°C) often provides the best balance of yield and activity . Purification should achieve ≥85% purity as determined by SDS-PAGE .

How can researchers verify the structure and activity of purified recombinant plsY?

Verification of recombinant plsY requires multiple complementary approaches:

Structural validation:

  • Circular dichroism spectroscopy to assess secondary structure elements

  • Size exclusion chromatography to evaluate oligomeric state

  • Limited proteolysis to confirm proper folding

  • Mass spectrometry for accurate molecular weight determination

Functional validation:

  • Enzymatic activity assay measuring acyl transfer to glycerol-3-phosphate

  • Substrate specificity analysis using various acyl donors

  • pH and temperature optimum determination

  • Inhibition studies with known acyltransferase inhibitors

Western blotting with specific antibodies can confirm identity, while thermal shift assays can assess stability under various buffer conditions. For membrane proteins like plsY, reconstitution into liposomes may be necessary to accurately measure native-like activity .

How does growth phase affect plsY expression in Brucella melitensis?

Research on B. melitensis has demonstrated that growth phase significantly impacts bacterial invasiveness and gene expression patterns. Studies have shown that B. melitensis at late-log phase exhibits higher invasiveness in non-phagocytic cells than bacteria at early-log or stationary phases . This growth phase-dependent variation affects approximately 454 Brucella genes that are differentially expressed between the most and least invasive growth phases .

To characterize plsY expression across growth phases:

  • Culture B. melitensis under standardized conditions and collect samples at defined growth points (early-log, mid-log, late-log, and stationary)

  • Extract RNA and perform RT-qPCR with plsY-specific primers

  • Use Western blotting to quantify protein levels

  • Create reporter constructs (plsY promoter-GFP) to monitor expression in real-time

  • Compare expression patterns with invasion efficiency and membrane composition

This approach will establish the relationship between growth phase, plsY expression, and virulence-associated phenotypes.

What biosafety considerations are essential when working with recombinant B. melitensis plsY?

Working with recombinant proteins derived from B. melitensis requires careful attention to biosafety:

BSL LevelMaterialsRequired ProceduresFacility Requirements
BSL-2Recombinant plsY expressed in non-pathogenic hostsStandard microbiological practices, PPE, biosafety cabinetRestricted access, hand washing sink, autoclave
BSL-3Live B. melitensis cultures, native protein isolationEnhanced PPE, double containment, respiratory protectionControlled access, negative pressure, HEPA filtration

How does the structure of plsY in B. melitensis compare with homologous enzymes in other bacterial pathogens?

Comparative structural analysis of plsY across bacterial species provides insights into functional conservation and potential Brucella-specific adaptations:

Analysis ApproachMethodologyExpected OutcomesResearch Applications
Sequence comparisonMultiple sequence alignment, phylogenetic analysisConservation mapping, identification of Brucella-specific residuesTarget validation, inhibitor design
Homology modelingThreading against known structures, molecular dynamicsPredicted 3D structure, substrate binding pocket analysisStructure-based drug design
Experimental structure determinationX-ray crystallography, cryo-EMHigh-resolution structure, cofactor interactionsDefinitive structural insights

Research indicates that membrane-associated proteins in Brucella often contain unique structural features that contribute to pathogen-specific functions . By comparing plsY across species, researchers can identify conserved catalytic residues versus pathogen-specific adaptations, guiding both fundamental understanding and therapeutic development.

What transcriptomic approaches can reveal the regulatory network controlling plsY expression during infection?

Understanding the regulation of plsY requires comprehensive transcriptomic analysis:

  • Experimental design considerations:

    • Time-course sampling during infection (4h, 12h, 24h, 48h post-infection)

    • Comparison between intracellular bacteria and in vitro cultures

    • Multiple infection models (macrophages, epithelial cells, animal tissues)

  • RNA isolation and enrichment methods:

    • Selective capture of transcribed sequences (SCOTS) for bacterial RNA from host cells

    • Dual RNA-seq to simultaneously profile host and pathogen responses

    • Linear amplification protocols biased to pathogen transcripts from mixed host-pathogen samples

  • Data analysis approaches:

    • Differential expression analysis across infection stages

    • Co-expression network construction to identify plsY-correlated genes

    • Transcription factor binding site prediction in promoter regions

    • Dynamic Bayesian modeling to establish causality in gene networks

Previous research on B. melitensis has revealed distinct transcriptional profiles at different infection timepoints, with a common down-regulation at 4h post-infection that reverses by 12h post-infection . This temporal pattern may indicate regulatory mechanisms affecting membrane-associated proteins like plsY during adaptation to intracellular environments.

How do mutations in plsY affect Brucella melitensis lipid metabolism and virulence?

Investigating the impact of plsY mutations requires integrated approaches:

Mutation TypeGeneration MethodAnalysis TechniqueExpected Phenotypes
Catalytic site mutationsSite-directed mutagenesisEnzymatic activity assaysReduced acyltransferase activity
Substrate binding mutationsAlanine scanningSubstrate affinity determinationAltered substrate specificity
Regulatory domain mutationsTruncation analysisExpression level measurementDysregulated expression
Conditional knockdownInducible antisense RNAMembrane composition analysisPhospholipid profile changes

The functional consequences of these mutations should be assessed through:

  • Lipidomic analysis using mass spectrometry to quantify changes in phospholipid species

  • Membrane fluidity measurements using fluorescent probes

  • Stress response evaluation (pH, temperature, oxidative stress tolerance)

  • Intracellular survival assays in macrophages and epithelial cells

  • Animal infection models to assess virulence attenuation

Research has demonstrated that membrane integrity is critical for B. melitensis virulence, with disruptions in membrane-associated proteins significantly impairing intracellular survival and pathogenicity .

What is the relationship between plsY activity and the unique intracellular lifestyle of Brucella melitensis?

B. melitensis employs sophisticated strategies for intracellular survival, likely involving membrane adaptations mediated by plsY:

  • Temporal aspects of plsY regulation during infection:

    • Research shows distinct transcriptional profiles of B. melitensis at 4h versus 12h post-infection

    • Early downregulation may represent adaptation to intracellular environment

    • Later upregulation correlates with establishment of replicative niche

  • Environmental factors affecting plsY function:

    • pH changes during endosomal trafficking

    • Nutrient availability within the Brucella-containing vacuole

    • Host-derived antimicrobial compounds targeting bacterial membranes

  • Methodological approaches to study plsY in the infection context:

    • Fluorescent microscopy with membrane-specific dyes

    • Live-cell imaging of reporter strains during infection

    • Correlative light-electron microscopy to visualize membrane structures

    • Selective sampling of bacteria from different intracellular compartments

The virB operon, essential for B. melitensis intracellular survival, has been shown to be critical during early infection stages . As a membrane-associated protein, plsY may contribute to creating optimal membrane properties required for virB function and intracellular adaptation.

How can systems biology approaches integrate transcriptomic, proteomic, and metabolomic data to understand plsY function?

Multi-omics integration provides comprehensive insights into plsY's role:

Omics LayerRelevant TechnologiesSpecific ApplicationsIntegration Approach
TranscriptomicsRNA-seq, RT-qPCRplsY expression patterns, co-regulated genesCorrelation networks
ProteomicsLC-MS/MS, protein arraysplsY protein levels, interacting partnersProtein-protein interaction maps
MetabolomicsLipidomics, flux analysisPhospholipid profiles, metabolic consequencesPathway mapping
PhenomicsGrowth assays, virulence measurementsFunctional outcomesPhenotype correlation

Integration strategies:

  • Multi-omics factor analysis to identify coordinated changes across datasets

  • Genome-scale metabolic modeling incorporating expression data

  • Bayesian network reconstruction to infer causal relationships

  • Machine learning approaches to identify predictive biomarkers

Previous research has successfully employed parallel gene expression profiling of B. melitensis and host cells to characterize infection dynamics . Similar approaches focused on plsY would provide a systems-level understanding of its regulatory context and functional impact on bacterial physiology and virulence.

What are the challenges in developing small molecule inhibitors targeting B. melitensis plsY?

Developing inhibitors against plsY faces several challenges:

  • Target validation requirements:

    • Confirmation of essentiality through conditional knockdown systems

    • Demonstration of adequate druggability of binding sites

    • Verification of conservation across Brucella strains and biotypes

  • Assay development considerations:

    • Establishing reliable enzymatic assays compatible with high-throughput screening

    • Developing cell-based secondary assays to confirm cell penetration

    • Creating counter-screens to identify non-specific or cytotoxic compounds

  • Chemical starting points:

    • Substrate mimetics based on glycerol-3-phosphate or acyl donors

    • Fragment-based approaches targeting allosteric sites

    • Repurposing of known acyltransferase inhibitors from other systems

  • Optimization challenges:

    • Achieving selectivity over mammalian acyltransferases

    • Ensuring adequate penetration of bacterial membranes

    • Maintaining activity in the acidic intracellular environment

Successful inhibitor development would benefit from structural information on B. melitensis plsY and careful consideration of the unique aspects of the intracellular bacterial lifestyle during drug design and optimization.

How does host cell type affect the expression and function of plsY during B. melitensis infection?

B. melitensis can infect multiple cell types with potentially different effects on plsY:

Host Cell TypeInfection CharacteristicsExpected plsY ResponseAnalytical Approach
MacrophagesOxidative stress, antimicrobial peptidesUpregulation to maintain membrane integrityComparative transcriptomics
Epithelial cellsLess microbicidal, different nutrient profilePotential shift in substrate specificityLipidomic analysis
TrophoblastsReproductive tissue tropismPossible specialized membrane adaptationsCell-specific infection models
Dendritic cellsAntigen presentation, immune activationExpression changes to evade detectionImmunological outcome correlation

Research approaches:

  • Parallel infection of different cell types followed by bacterial RNA isolation

  • Cell-specific infection models using primary cells from relevant tissues

  • Ex vivo tissue explant infections to maintain physiological context

  • In vivo sampling from different infected tissues

Previous studies have demonstrated that B. melitensis can be isolated from intestinal Peyer's patches as soon as 15 minutes post-infection and from systemic blood after 30 minutes, indicating rapid adaptation to different host environments . The expression of plsY likely plays a role in these adaptation processes across diverse host niches.

What protocols enable effective isolation of recombinant plsY from expression systems?

The purification of recombinant plsY requires optimization at several steps:

Purification StepRecommended MethodsCritical ParametersQuality Control
Cell lysisSonication or French press for membrane proteinsBuffer composition, detergent selectionMicroscopic examination
Membrane isolationUltracentrifugation, sucrose gradientSpeed, temperature, durationMarker enzyme assays
SolubilizationDetergent screening (DDM, LDAO, OG)Detergent:protein ratio, time, temperatureSolubility assessment
Affinity chromatographyIMAC for His-tagged proteinsImidazole concentration, flow rateSDS-PAGE, Western blot
Size exclusionHigh-resolution columnsBuffer composition, detergent concentrationA280 profile, oligomeric state

For membrane proteins like plsY, detergent selection is critical for maintaining native structure and function. The purification should achieve ≥85% purity as determined by SDS-PAGE , with verification of identity by Western blotting or mass spectrometry. Activity assays at each purification step can track retention of enzymatic function.

How can researchers develop specific antibodies against B. melitensis plsY for research applications?

Development of high-quality antibodies requires careful antigen design:

  • Antigen selection strategies:

    • Recombinant full-length protein in detergent micelles

    • Synthetic peptides from predicted antigenic epitopes

    • Extramembrane domain expression as soluble fragments

  • Immunization protocols:

    • Selection of appropriate animal models (rabbits, mice, chickens)

    • Prime-boost strategies with adjuvant optimization

    • Monitoring antibody titers via ELISA

  • Antibody purification and validation:

    • Affinity purification against immobilized antigen

    • Cross-reactivity testing against related proteins

    • Application-specific validation (Western blot, immunoprecipitation, immunofluorescence)

  • Quality control parameters:

    • Specificity assessment using knockout/knockdown controls

    • Sensitivity determination through limit of detection studies

    • Lot-to-lot consistency evaluation

Well-characterized antibodies enable numerous applications including protein localization, expression level monitoring, and protein-protein interaction studies essential for understanding plsY biology.

What are the optimal conditions for enzymatic assays to measure plsY activity?

Establishing reliable enzymatic assays is essential for functional characterization:

Assay ComponentRecommended ConditionsOptimization ParametersDetection Method
Substrate concentration10-100 μM glycerol-3-phosphateKm determinationRadiometric (14C-labeled)
Acyl donorAcyl-CoA or acyl-ACPChain length, saturationFluorescent assays
Buffer composition50 mM Tris-HCl, pH 7.5, 10 mM MgCl2pH, ionic strengthCoupled enzyme systems
Detergent0.01-0.05% DDM or other compatible detergentCMC considerationsHPLC-based methods
Temperature30-37°CThermal stabilityMass spectrometry

Control reactions should include:

  • Heat-inactivated enzyme to establish baseline

  • Known inhibitors to confirm specificity

  • Commercially available related enzymes as positive controls

  • Substrate or cofactor omission controls

These enzymatic assays provide the foundation for inhibitor screening, mutational analysis, and structure-function studies crucial for understanding plsY biology and developing potential therapeutics.

How can researchers apply CRISPR-Cas9 technology to study plsY function in Brucella melitensis?

CRISPR-Cas9 offers powerful approaches for studying plsY:

  • Gene editing strategies:

    • Complete knockout may be lethal if plsY is essential

    • Point mutations to alter specific residues

    • Promoter modifications to alter expression levels

    • Epitope tagging for protein localization and interaction studies

  • Technical considerations for Brucella:

    • Selection of appropriate Cas9 delivery system

    • Optimization of transformation efficiency

    • Design of guide RNAs with minimal off-target effects

    • Homology-directed repair template design

  • Alternative CRISPR applications:

    • CRISPRi for inducible gene repression

    • CRISPRa for controlled upregulation

    • CRISPR screening to identify genetic interactions

  • Validation approaches:

    • Sequencing to confirm intended modifications

    • RT-qPCR and Western blotting to verify expression changes

    • Phenotypic characterization in cellular and animal models

Given the potential essentiality of plsY, CRISPR interference (CRISPRi) approaches may be particularly valuable for creating conditional knockdowns for functional studies without complete gene deletion.

What computational methods can predict substrate specificity and inhibitor binding to B. melitensis plsY?

Computational approaches provide valuable insights into plsY function:

Computational MethodApplicationRequired InputExpected Output
Homology modelingStructure predictionplsY sequence, template structures3D structural model
Molecular dockingSubstrate/inhibitor bindingProtein structure, ligand librariesBinding modes, affinity predictions
Molecular dynamicsDynamic behavior3D structure, force field parametersConformational changes, stability assessment
Quantum mechanicsReaction mechanismActive site coordinatesTransition state structures, energy barriers

Implementation strategy:

  • Construct homology models based on related acyltransferases with known structures

  • Validate models through energy minimization and structural assessment tools

  • Dock natural substrates to identify key binding interactions

  • Perform virtual screening of compound libraries for potential inhibitors

  • Use molecular dynamics simulations to assess stability of predicted complexes

These computational approaches can guide experimental work by identifying promising inhibitor scaffolds and predicting the impact of mutations on substrate specificity and catalytic activity.

How should researchers analyze and interpret contradictory results in plsY functional studies?

Contradictory results require systematic investigation:

  • Sources of experimental variation:

    • Strain differences between B. melitensis isolates

    • Expression system variations affecting protein folding

    • Assay conditions impacting enzyme activity

    • Host cell types in infection models

  • Resolution strategies:

    • Replicate experiments with standardized protocols

    • Use multiple complementary techniques to assess the same parameter

    • Employ different expression systems and purification strategies

    • Test hypotheses in both in vitro biochemical and cellular contexts

  • Systematic validation approaches:

    • Genetic complementation to confirm phenotype specificity

    • Dose-response relationships to establish causality

    • Time-course studies to capture temporal dynamics

    • Independent verification in different laboratories

When analyzing contradictory results, researchers should consider that growth-phase dependent regulation, as observed in B. melitensis transcriptional profiles , may affect experimental outcomes depending on the bacterial culture conditions used.

What statistical approaches are appropriate for analyzing plsY expression data across different experimental conditions?

Data TypeRecommended Statistical MethodsAssumptionsVisualization Approach
RT-qPCRΔΔCt method, ANOVA with post-hoc testsNormality, equal varianceBar charts with error bars
RNA-seqDESeq2, edgeRNegative binomial distributionVolcano plots, heatmaps
ProteomicsLimma, MSstatsSample independencePCA plots, protein networks
Enzyme kineticsNon-linear regression, Michaelis-MentenSubstrate excessMichaelis-Menten curves

Important considerations:

  • Power analysis to determine appropriate sample sizes

  • Multiple testing correction (Benjamini-Hochberg, Bonferroni)

  • Effect size calculation beyond p-value significance

  • Biological replicates versus technical replicates

  • Appropriate reference gene selection for expression normalization

For time-course experiments, methods like EDGE, maSigPro, or spline-based approaches may better capture temporal patterns in plsY expression during infection or under stress conditions.

How can researchers effectively integrate findings from plsY studies with the broader understanding of Brucella pathogenesis?

Integration of plsY research into the broader pathogenesis context:

  • Multi-scale integration approaches:

    • Connect molecular findings (enzyme activity) to cellular phenotypes (membrane properties)

    • Link cellular observations to tissue-level infection dynamics

    • Relate in vitro findings to in vivo infection models

  • Cross-disciplinary integration:

    • Biochemical characterization with structural biology insights

    • Genetic studies with transcriptomic/proteomic profiles

    • In vitro models with ex vivo and in vivo observations

  • Contextual analysis frameworks:

    • Pathway analysis to position plsY within bacterial metabolic networks

    • Virulence factor interactome mapping

    • Host-pathogen interaction networks

    • Temporal staging of virulence mechanisms during infection

  • Synthesis and hypothesis generation:

    • Systems biology modeling of plsY's role in infection

    • Predictive models of intervention outcomes

    • Comparative analysis across Brucella species and biotypes

Research has demonstrated that multiple virulence factors, including the virB operon and MAPK1 expression, are critical for early B. melitensis intracellular survival . Understanding how plsY interacts with these established virulence mechanisms will provide a more comprehensive picture of Brucella pathogenesis.

What emerging technologies could advance our understanding of plsY function in Brucella melitensis?

Several cutting-edge technologies offer new opportunities:

TechnologyApplication to plsY ResearchPotential InsightsTechnical Challenges
Cryo-electron tomographyVisualization of membrane organizationNative context of plsY in bacterial membraneSample preparation, resolution
Single-cell RNA-seqExpression heterogeneity analysisSubpopulation-specific regulationBacterial RNA isolation, coverage
CRISPR-based screeningGenetic interaction mappingSynthetic lethal partners, resistance mechanismsLibrary generation, screening conditions
Native mass spectrometryProtein complex characterizationInteraction partners, stoichiometryMembrane protein analysis
Proximity labelingIn situ interaction networkSpatial organization, transient interactionsTag interference, specificity

Additional emerging approaches include:

  • Time-resolved structural studies to capture catalytic intermediates

  • Microfluidic systems for controlled infection environments

  • Organ-on-chip models for host-pathogen interactions

  • Machine learning for integration of multi-dimensional datasets

These technologies can provide unprecedented insights into plsY function in its native context, advancing both fundamental understanding and applied therapeutic development.

What are the most promising strategies for targeting plsY in the development of new anti-Brucella therapeutics?

Several therapeutic strategies warrant exploration:

  • Direct enzyme inhibition approaches:

    • Substrate analog development

    • Allosteric inhibitors targeting regulatory sites

    • Covalent inhibitors for prolonged engagement

    • Natural product derivatives with acyltransferase inhibitory activity

  • Alternative targeting strategies:

    • Disruption of protein-protein interactions essential for function

    • Targeting plsY expression through upstream regulators

    • Membrane-disrupting agents working synergistically with plsY inhibition

    • Immune-based therapies enhancing clearance of compromised bacteria

  • Combination therapy approaches:

    • Synergistic combinations with existing antibiotics

    • Multi-target strategies affecting multiple steps in phospholipid biosynthesis

    • Host-directed therapies combined with bacterial targeting

  • Delivery strategies for intracellular targeting:

    • Liposomal formulations for macrophage targeting

    • Cell-penetrating peptide conjugates

    • Nanoparticle-based delivery systems

Immunoinformatics approaches similar to those used for designing multi-epitope vaccines against B. melitensis could potentially be adapted to identify immunogenic regions of plsY for immunotherapy development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.