Recombinant Brucella melitensis biotype 2 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
mscL; BMEA_A0356; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella melitensis biotype 2 (strain ATCC 23457)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mscL protein and what is its role in Brucella melitensis?

The large-conductance mechanosensitive channel (mscL) in Brucella melitensis is a membrane protein that responds to mechanical forces in the cell membrane. Similar to other bacterial mechanosensitive channels, it likely functions as a protective mechanism against osmotic stress by opening in response to increased membrane tension and allowing the release of cytoplasmic osmolytes, thereby protecting bacteria from membrane damage during high turgor pressure . In Brucella melitensis biotype 2, the mscL protein consists of 138 amino acids and forms a homopentameric channel in the bacterial membrane . This channel is one of the largest pores found in nature, with a diameter exceeding 25 Å when fully open, allowing the passage of large organic ions and small proteins .

How does mscL compare to other mechanosensitive channels in bacteria?

MscL represents one of two main types of bacterial mechanosensitive channels: the mechanosensitive channel of large conductance (MscL) and the mechanosensitive channel of small conductance (MscS). These channels differ in their sensitivity to membrane tension and pore size :

FeatureMscLMscS
Conductance3.6 nS1.0 nS
SensitivityLess sensitive (requires larger stimulus)More sensitive
Open pore durationShorterLonger
Pore diameter>25 ÅSmaller
StructureHomopentamerHomoheptamer

MscL channels are highly conserved across bacterial species, with Brucella melitensis MscL showing structural and functional similarities to the extensively studied Escherichia coli MscL and Mycobacterium tuberculosis MscL .

What are the key functional domains in mscL that contribute to mechanosensitivity?

Based on studies of MscL proteins, several key domains contribute to the mechanosensitivity of the channel :

  • Transmembrane helices (TM1 and TM2): TM1 forms the pore lining of the channel, while TM2 interacts with the membrane lipids. Mutations in TM1, particularly hydrophilic substitutions, often result in gain-of-function phenotypes with increased channel sensitivity.

  • S1 amphipathic helix (N-terminal domain): This domain interacts strongly with lipids during channel expansion and is directly connected to the pore-lining segment, playing a crucial role in sensing membrane tension.

  • Transmembrane pockets: Located at the interface between transmembrane helices, these pockets interact with lipid acyl chains. The number of lipid acyl chains occupying these pockets appears to determine the conformational state of the protein.

  • Pore constriction site: Located around the first transmembrane helix (TM1), this region forms the narrowest part of the channel pore in the closed state. Mutations here (like G22 substitutions) can significantly alter channel gating properties.

  • Cytoplasmic-membrane interface: This region is a target for chemical compounds that modulate MscL activity, including antibiotics like dihydrostreptomycin (DHS) .

What are the optimal expression systems for producing recombinant Brucella melitensis mscL?

Based on the search results and established practices for MscL proteins, the following expression systems have been successfully used:

  • Escherichia coli-based expression: The most commonly used system involves expressing mscL as a recombinant protein in E. coli, typically using strains like BL21(DE3) . E. coli expression systems allow for high protein yields and established purification protocols.

  • Expression as a fusion protein: To improve solubility and facilitate purification, mscL can be expressed as a fusion protein with tags such as:

    • His-tag (polyhistidine tag)

    • GST (glutathione S-transferase)

  • Vector selection: Vectors like pET28a(+) have been successfully used for Brucella protein expression .

  • Induction conditions: Typically, expression is induced with 1mM IPTG, though optimization may be required for the specific construct .

  • Alternative expression systems: For specific applications requiring post-translational modifications, Pichia pastoris (a yeast expression system) has shown slightly higher expression levels and immunogenicity for some Brucella recombinant proteins compared to E. coli .

What purification strategy yields the highest purity and activity for recombinant mscL?

A multi-step purification strategy is typically employed to obtain high-purity, functional mscL protein :

  • Initial capture based on affinity tag:

    • For His-tagged proteins: Ni-NTA agarose resin affinity chromatography, with elution using imidazole (typically 250mM)

    • For GST-fusion proteins: Glutathione-coated beads, with elution using reduced glutathione or cleavage using thrombin

  • Tag removal (if necessary):

    • Thrombin cleavage for GST-fusion proteins

    • TEV protease for His-tagged proteins with TEV cleavage sites

  • Dialysis: To remove imidazole or other elution agents

  • Storage conditions:

    • Store at -20°C or -80°C for extended storage

    • For the Brucella melitensis biotype 2 mscL specifically, storage in Tris-based buffer with 50% glycerol is recommended

    • Working aliquots can be stored at 4°C for up to one week

  • Quality control:

    • SDS-PAGE to verify purity (target >90%)

    • Western blotting to confirm identity

    • Functional reconstitution assays to verify activity

How can researchers verify the functional activity of purified recombinant mscL?

Several methods are available to verify the functional activity of purified recombinant mscL :

  • Liposome reconstitution and patch-clamp analysis:

    • Reconstitute purified mscL into artificial liposomes

    • Perform patch-clamp recordings to measure channel conductance and pressure sensitivity

    • Verify characteristic conductance (approximately 3.6 nS for MscL)

    • Test blockage by known mechanosensitive channel inhibitors such as gadolinium

  • Droplet hydrogel bilayer (DHB) assays:

    • Incorporate mscL into planar supported lipid bilayers

    • Activate channels by mechanical stimulation (e.g., by injecting buffer to stretch the membrane)

    • Measure resulting current changes

  • Cell survival assays:

    • Transform mscL-deficient bacterial strains with the recombinant mscL

    • Subject cells to hypoosmotic shock

    • Measure survival rates compared to control strains

  • Antibody binding assays:

    • Use specific anti-MscL polyclonal antibodies to verify protein identity

    • These antibodies can also be used to test functional inhibition of the channel

What approaches can be used to modulate mscL channel activity for experimental purposes?

Several approaches have been developed to modulate MscL channel activity, which could be applied to Brucella melitensis mscL :

  • Site-directed mutagenesis:

    • G22S mutation: Lowers activation threshold while maintaining gating characteristics

    • G22E mutation: Creates spontaneously active channels

    • L89W (or equivalent in B. melitensis mscL): Stabilizes an expanded subconducting state

    • Hydrophilic substitutions in TM1: Typically result in gain-of-function phenotypes

    • Hydrophilic substitutions at the end of TM1 and TM2: Can eliminate mechanosensitivity

  • Chemical modifications:

    • Introduction of cysteine mutations (e.g., G22C) followed by sulfhydryl-reactive modulator attachment

    • pH-sensitive modulators attached to pore residues

    • Light-sensitive compounds for optogenetic control

  • Membrane environment manipulation:

    • Alterations in bilayer thickness

    • Changes in membrane stiffness

    • Modification of spontaneous curvature of the lipid monolayer

    • Application of amphipaths that insert into one leaflet of the membrane

  • Pharmacological modulation:

    • Antibiotics like dihydrostreptomycin (DHS) that bind at the subunit interface near the constriction site

    • Compounds targeting the cytoplasmic-membrane interface region

What is the immunogenic potential of Brucella melitensis mscL and how does it compare to other Brucella antigens?

While the search results don't directly address the immunogenicity of mscL specifically, we can infer from studies of other Brucella membrane proteins:

  • Immunogenicity assessment:

    • Membrane proteins of Brucella, particularly outer membrane proteins (OMPs), are known to be immunogenic

    • The immunogenic potential of mscL would need to be experimentally determined through:

      • ELISA assays with sera from infected animals/humans

      • T-cell proliferation assays

      • Cytokine production analysis

  • Comparison with well-characterized immunogenic proteins:

    • Omp25 (25 kDa), Omp28, Omp31 (31 kDa): Well-established immunogenic proteins that induce both humoral and cellular immune responses

    • L7/L12 ribosomal protein: Demonstrated protection against B. abortus infection

    • BCSP31 (31 kDa cell surface protein): Immunogenic and protective when conjugated to detoxified LPS

  • Immune response characteristics:

    • Effective Brucella antigens typically induce a Th1-type response with production of IFN-γ and IL-2

    • Both CD4+ and CD8+ T-cell responses contribute to protection, with CD4+ T cells playing a dominant role

How can recombinant mscL be incorporated into vaccine development strategies against brucellosis?

Based on approaches used with other Brucella recombinant proteins :

  • Subunit vaccine approaches:

    • Direct immunization with purified recombinant mscL protein

    • Combination with appropriate adjuvants (e.g., incomplete Freund's adjuvant, TPPPS)

    • Multi-epitope formulations combining mscL with other immunogenic proteins

  • Conjugate vaccine design:

    • Conjugation of mscL to detoxified Brucella LPS, as demonstrated with BCSP31

    • Combination with other carrier proteins to enhance immunogenicity

  • Epitope identification and peptide vaccines:

    • Computational prediction of B-cell and T-cell epitopes using immunoinformatics approaches (ABCpred, Bcepred, RANKPEP, SYFPEITHI, MHCPred, CTLPred)

    • Testing of synthetic peptides derived from predicted epitopes

    • Development of multi-epitope constructs linked by flexible linkers

  • Evaluation protocol:

    • In silico analysis: Allergenicity (AllerTOP 2.0), antigenicity (Vaxijen), physiochemical properties (ProtParam), solubility (Protein-sol)

    • In vitro testing: T-cell activation, cytokine production

    • In vivo protection studies: Challenge with virulent Brucella strains, measurement of bacterial load in spleen, protection level assessment

How can recombinant mscL be utilized for controlled delivery of bioactive molecules into cells?

The large pore size of MscL (>25 Å) makes it an excellent candidate for controlled molecular delivery into cells :

  • Controlled activation strategies:

    • Engineering MscL with charge-induced activation mechanisms

    • Creating MscL variants responsive to specific stimuli (pH, light, etc.) through site-directed mutagenesis and chemical modification

    • Application of mechanical force to activate wild-type or sensitized MscL variants

  • Delivery applications:

    • Introduction of membrane-impermeable molecules like bi-cyclic peptides (e.g., phalloidin)

    • Delivery of bioactive compounds, fluorescent probes, or other molecular cargoes

    • Size-selective delivery based on the MscL pore dimensions

  • Experimental implementation:

    • Functional expression of recombinant mscL in mammalian cell membranes

    • Verification of gating in response to increased membrane tension

    • Co-delivery of target molecules during channel activation

    • Assessment of delivery efficiency and cargo functionality

  • Potential advantages:

    • Rapid controlled uptake of membrane-impermeable molecules

    • Temporal control of delivery through regulated channel activation

    • Potential for targeting specific cell types through promoter-controlled expression

What role does mscL play in Brucella pathogenesis and host-pathogen interactions?

While the specific role of mscL in Brucella pathogenesis isn't directly addressed in the search results, several insights can be inferred:

  • Potential functions in bacterial survival:

    • Protection against osmotic stress during infection and host cell transitions

    • Adaptation to environmental changes within the host

    • Possible involvement in stationary phase survival, similar to E. coli MscL which is part of the RpoS regulon

  • Gene expression patterns:

    • Similar to other Brucella genes, mscL expression may vary during different growth phases

    • Studies of B. melitensis gene expression show that bacteria at late logarithmic phase are more invasive to HeLa cells than those in stationary phase

    • The mscL gene (BMEA_A0356) may be regulated as part of adaptation to intracellular environments

  • Interaction with host proteins:

    • While not specific to mscL, other Brucella membrane proteins like Omp25 interact with host cell proteins (e.g., ferritin heavy polypeptide 1 in trophoblast cells)

    • These interactions can affect host inflammatory responses and intracellular survival

  • Potential as a drug target:

    • MscL has been identified as a valid drug target in other bacteria

    • Antibiotics like streptomycin can use MscL as a path to the cytoplasm

    • Novel specific agonist compounds targeting MscL have been developed

What advanced structural characterization techniques are most effective for studying mscL conformational changes?

Based on studies of MscL proteins, several advanced techniques have proven valuable for structural characterization :

  • Spectroscopic approaches:

    • Continuous wave electron paramagnetic resonance (cwEPR) spectroscopy to study protein-lipid interactions

    • Pulsed electron-electron double resonance (PELDOR/DEER) spectroscopy for high-resolution distance measurements during conformational changes

    • Electron spin echo envelope modulation (ESEEM) spectroscopy to follow structural transitions

  • Mass spectrometry techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to characterize expanded states and conformational changes

    • Cross-linking mass spectrometry to identify interacting regions

  • Computational methods:

    • Molecular dynamics (MD) simulations to model channel behavior under membrane tension

    • Simulations of pore hydration during expansion

    • Modeling of interactions between the channel and modulatory compounds

  • X-ray crystallography and cryo-EM:

    • Determination of closed, intermediate, and open state structures

    • Visualization of interactions with ligands or modulatory compounds

    • Analysis of structural changes induced by specific mutations

  • Methodological considerations:

    • Incorporation of site-specific spin labels or fluorescent probes at strategic positions

    • Use of membrane mimetics such as nanodiscs for maintaining native-like environment

    • Comparison of multiple techniques to validate structural models

These advanced techniques provide complementary information that together can elucidate the complex structural transitions involved in mscL channel gating and modulation.

What are common challenges in working with recombinant mscL and how can they be addressed?

Based on experiences with membrane proteins and MscL specifically:

  • Protein solubility issues:

    • Problem: Membrane proteins like mscL are often difficult to solubilize

    • Solutions:

      • Use of fusion partners (GST, MBP) to enhance solubility

      • Co-expression with chaperones like Skp

      • Optimization of detergent type and concentration

      • Use of amphipols or nanodiscs for maintaining native-like environment

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Codon optimization for the expression host

      • Use of strong inducible promoters

      • Selection of appropriate expression strains (e.g., C41(DE3), C43(DE3) for membrane proteins)

      • Lowering induction temperature (e.g., 18-25°C)

      • Addition of membrane-stabilizing compounds to growth media

  • Functional assessment challenges:

    • Problem: Verifying channel functionality requires specialized equipment

    • Solutions:

      • Collaboration with electrophysiology laboratories

      • Use of fluorescence-based liposome assays as alternatives to patch-clamp

      • Complementation assays in MscL-deficient bacterial strains

  • Protein degradation during purification:

    • Problem: Proteolytic degradation, especially of tags

    • Solutions:

      • Addition of protease inhibitors during purification

      • Use of protease-deficient expression strains

      • Optimization of purification speed and temperature

      • Selection of more stable tags or tag placement

  • Storage stability:

    • Problem: Functional deterioration during storage

    • Solutions:

      • Addition of stabilizing agents (glycerol, specific lipids)

      • Avoiding repeated freeze-thaw cycles

      • Storage of working aliquots at 4°C for short-term use

      • Flash-freezing in liquid nitrogen for long-term storage

How can researchers optimize recombinant mscL for specific experimental applications?

Optimization strategies depend on the specific application:

  • For structural studies:

    • Construct design with minimal flexible regions

    • Addition of stabilizing mutations

    • Use of thermostable orthologs or engineered variants

    • Expression conditions favoring proper folding over quantity

  • For functional reconstitution:

    • Careful selection of lipid composition to mimic native environment

    • Optimization of protein-to-lipid ratios

    • Gentle reconstitution procedures to maintain activity

    • Verification of orientation in reconstituted systems

  • For immunological studies:

    • Expression systems producing proteins with native-like epitopes

    • Removal of fusion tags that might interfere with immune recognition

    • Careful purification to remove immunogenic contaminants

    • Appropriate adjuvant selection for immunization studies

  • For molecular delivery applications:

    • Engineering variants with appropriate gating properties

    • Optimization of activation mechanisms for specific cell types

    • Balancing pore size with selectivity requirements

    • Ensuring compatibility with delivery cargo

  • Design of mutations for specific properties:

    • G22 substitutions for altered gating sensitivity

    • Introduction of cysteine residues for site-specific labeling

    • Modifications at the cytoplasmic-membrane interface for altered tension sensing

    • Mutations in transmembrane pockets to affect lipid interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.