Recombinant Brucella melitensis biotype 2 Protease HtpX homolog (htpX)

What is the amino acid sequence and structural characteristics of Brucella HtpX protease?

The Brucella HtpX protease is a full-length protein consisting of 325 amino acids. The complete amino acid sequence is: "MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQEVDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLSPEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTLLAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEHNPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNSGPWGQRSDNAGGNSNGGSRYRGPWS" . Structurally, the protein contains multiple hydrophobic regions that likely function as transmembrane segments, anchoring it within the bacterial cytoplasmic membrane. As a member of the M48 family of zinc metalloproteinases, the Brucella HtpX protease contains a conserved HEXXH motif in its active site, which coordinates a zinc ion essential for its catalytic activity . The protein is typically expressed with an N-terminal His-tag when produced as a recombinant protein for research purposes, which facilitates purification and detection without significantly affecting its proteolytic function . Bioinformatic analyses suggest that the protein contains four potential transmembrane regions (H1-H4), although there remains some controversy about whether the two C-terminal regions are truly embedded in the membrane .

How does the expression of htpX vary during different growth phases of Brucella?

The expression of htpX in Brucella species varies significantly during different growth phases, with important implications for bacterial invasion and pathogenesis. Studies examining gene expression profiles of B. melitensis have demonstrated differential expression patterns correlated with invasiveness to epithelial cells . During the late logarithmic growth phase, when B. melitensis exhibits its highest invasive capacity to HeLa cells, numerous genes show upregulation compared to the stationary phase (which shows the lowest invasiveness) . While the search results do not specifically mention htpX among these differentially regulated genes, the pattern of increased expression of genes associated with growth and metabolism during the late-log phase suggests that htpX may follow a similar expression pattern given its role in membrane protein quality control. Gene expression analysis has shown that B. melitensis cultures at late-log phase are approximately 2.2 times more invasive than mid-log cultures and 4.8 times more invasive than stationary phase cultures when co-incubated with HeLa cells . This growth phase-dependent variation in gene expression highlights the dynamic nature of bacterial pathogenesis mechanisms and suggests that research on htpX should carefully consider the growth phase of the bacterial culture when designing experiments.

What experimental approaches can be used to express and purify recombinant Brucella HtpX protease?

Recombinant Brucella HtpX protease can be efficiently expressed and purified using several established methodologies adapted for membrane proteins. The most common approach involves heterologous expression in E. coli systems using a full-length construct (amino acids 1-325) fused to an N-terminal His-tag to facilitate purification . Researchers typically clone the htpX gene into expression vectors containing strong promoters like T7 or tac, allowing for inducible expression in E. coli host strains such as BL21(DE3) or its derivatives. After induction, cells are harvested and lysed, and the membrane fraction containing the recombinant protein is solubilized using appropriate detergents such as n-dodecyl-β-D-maltoside or Triton X-100 to maintain protein structure and activity . Purification is commonly performed using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar matrices that bind the His-tagged protein, followed by size exclusion chromatography for further purification if needed. The purified protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, and many protocols recommend adding 5-50% glycerol for long-term storage at -20°C or -80°C to maintain enzymatic activity . For functional studies, the protein can be reconstituted into liposomes or nanodiscs to mimic its native membrane environment.

How can researchers develop an effective in vivo assay system for measuring Brucella HtpX protease activity?

Developing an effective in vivo assay system for measuring Brucella HtpX protease activity can be accomplished by adapting approaches similar to those used for E. coli HtpX. Researchers should construct a model substrate that allows for sensitive detection of protease activity, similar to the XMS1 (HtpX Model Substrate 1) developed for E. coli HtpX . This substrate should contain a reporter protein such as monomeric superfolder GFP (msfGFP) fused to a membrane-spanning segment that serves as a potential cleavage site for HtpX. The construct should be designed to allow detection of both the full-length product (XMS1-FL) and the cleaved fragments (CL-N and CL-C) using appropriate antibodies in Western blot analysis . For in vivo assays, the model substrate should be co-expressed with either wild-type HtpX or variant forms carrying mutations in conserved regions to evaluate differential protease activities. Researchers can establish a semiquantitative system by measuring the ratio of cleaved products to the full-length substrate under various experimental conditions, such as different growth phases or stress conditions that might affect HtpX activity. To validate the specificity of the assay, control experiments should include HtpX knockout strains and complementation studies, as well as inhibitor studies using metalloprotease inhibitors that target the zinc-binding site of HtpX .

What is the relationship between HtpX expression and Brucella virulence during host cell invasion?

The relationship between HtpX expression and Brucella virulence during host cell invasion represents a complex and potentially significant aspect of pathogenesis. Studies investigating B. melitensis gene expression during different growth phases have demonstrated that bacteria in the late logarithmic phase exhibit substantially higher invasiveness to epithelial cells compared to those in stationary phase . During this highly invasive phase, numerous genes associated with growth and metabolism show upregulation, including those involved in DNA replication, transcription, translation, intermediate metabolism, energy production, membrane transport, and biogenesis of the cell envelope - functional categories that could potentially include htpX given its role in membrane protein quality control . The specific role of htpX in Brucella virulence may be related to its function in maintaining membrane integrity during the stress of host cell invasion, potentially through the degradation of damaged or misfolded membrane proteins that could compromise bacterial survival. Researchers investigating this relationship should consider experimental approaches that combine gene expression analysis with invasion assays using wild-type and htpX-deficient Brucella strains to directly assess the impact of this protease on invasion efficiency . Additionally, time-course experiments examining htpX expression at different stages of host cell infection could provide valuable insights into its temporal regulation during the infection process.

How does the function of Brucella HtpX compare with homologs in other bacterial species like E. coli?

The function of Brucella HtpX likely shares fundamental similarities with its homologs in other bacterial species like E. coli, while potentially exhibiting species-specific adaptations related to Brucella's unique pathogenic lifestyle. Both proteins belong to the M48 family of zinc metalloproteinases and are located in the cytoplasmic membrane, where they contribute to proteolytic quality control of membrane proteins . The E. coli HtpX contains four hydrophobic regions that function as transmembrane segments, although the membrane embedding of the two C-terminal regions remains somewhat controversial - a structural feature that may be conserved in the Brucella homolog . Functionally, both proteins likely participate in the degradation of misfolded or damaged membrane proteins, with the E. coli HtpX particularly active under conditions where the primary membrane protein quality control protease FtsH is compromised or overwhelmed. Some bacterial HtpX homologs are known to be induced by membrane damage caused by aminoglycoside antibiotics or other stressors . A key difference may lie in substrate specificity, as the Brucella HtpX might target proteins specific to its pathogenic lifestyle, potentially including virulence factors or proteins involved in host-pathogen interactions. Comparative studies investigating the substrate preferences and regulatory mechanisms of both proteins would provide valuable insights into their conserved and divergent functions.

What methodologies can be used to identify the physiological substrates of Brucella HtpX?

Identifying the physiological substrates of Brucella HtpX requires a multi-faceted approach combining various proteomics and molecular biology techniques. Researchers should first establish an htpX knockout strain of Brucella and its complemented version to allow comparative analyses of the membrane proteome under different conditions . A quantitative proteomics approach using stable isotope labeling (such as SILAC) or label-free quantification can be employed to compare protein abundances between wild-type and ΔhtpX strains, potentially revealing proteins that accumulate in the absence of HtpX proteolytic activity. To detect transient protease-substrate interactions, crosslinking approaches combined with immunoprecipitation can be used, where catalytically inactive HtpX variants (with mutations in the HEXXH motif) may trap substrates more effectively by forming stable enzyme-substrate complexes . Another powerful approach involves constructing chimeric proteins containing potential substrate sequences fused to reporter proteins, similar to the XMS1 model substrate developed for E. coli HtpX, which can be tested for cleavage in vivo and in vitro . Additionally, researchers can employ global approaches such as N-terminomics (terminal amine isotopic labeling of substrates - TAILS) to identify specific cleavage sites generated by HtpX activity. Validation of candidate substrates should include in vitro cleavage assays using purified components and site-directed mutagenesis of potential cleavage sites to confirm direct HtpX-mediated proteolysis.

What are the optimal conditions for storing and handling recombinant Brucella HtpX protein?

The optimal conditions for storing and handling recombinant Brucella HtpX protein require careful consideration of factors that maintain protein stability and enzymatic activity. Recombinant HtpX protein is typically supplied as a lyophilized powder, which should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial . For reconstitution, researchers should use deionized sterile water to prepare a solution with a concentration of 0.1-1.0 mg/mL. To prevent protein degradation and maintain activity during storage, it is strongly recommended to add glycerol to a final concentration of 5-50% (with 50% being commonly used) and then aliquot the protein solution for long-term storage at -20°C or -80°C . Storage buffer composition significantly impacts protein stability, with a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 being reported as effective for maintaining HtpX integrity . Researchers should avoid repeated freeze-thaw cycles, as these can substantially reduce protein activity; instead, working aliquots should be stored at 4°C for up to one week . For experiments requiring active enzyme, researchers should consider the metal ion requirements of this zinc metalloproteinase, potentially supplementing reaction buffers with appropriate concentrations of zinc ions to ensure maximal enzymatic activity. When handling the protein for experimental procedures, maintaining appropriate temperature and pH conditions is crucial for preserving the native conformation and catalytic properties of this membrane-associated protease.

How does growth phase affect the expression and activity of Brucella HtpX during infection models?

Growth phase significantly impacts Brucella gene expression patterns and invasion capabilities, which likely extends to htpX expression and activity during infection models. Studies with B. melitensis have demonstrated that bacteria in the late logarithmic growth phase (OD = 0.4, approximately 2 × 10^9 CFU/ml) exhibit significantly higher invasiveness to epithelial cells compared to mid-log (OD = 0.18, approximately 0.5 × 10^9 CFU/ml) or stationary phase cultures (OD = 0.72, approximately 5 × 10^9 CFU/ml) . When using a consistent multiplicity of infection (MOI) of 1,000 bacteria per HeLa cell, late-log phase cultures showed 2.2 times higher invasion efficiency than mid-log cultures and 4.8 times higher efficiency than stationary phase cultures . This growth phase-dependent variation in invasiveness correlates with differential gene expression patterns, with 414 genes upregulated and 40 genes downregulated in late-log phase compared to stationary phase . The majority of upregulated genes in the highly invasive late-log phase were associated with growth processes, including DNA replication, transcription, translation, intermediate metabolism, energy production and conversion, membrane transport, and biogenesis of the cell envelope and outer membrane - categories that may include htpX given its role in membrane protein quality control . When designing infection experiments, researchers should standardize the growth phase of bacterial cultures to ensure reproducible results, with late-log phase cultures potentially providing the most physiologically relevant model for studying invasion-associated processes, including htpX activity.

What experimental controls are essential when investigating HtpX protease activity in Brucella?

When investigating HtpX protease activity in Brucella, several critical experimental controls must be incorporated to ensure reliable and interpretable results. First, researchers should include an htpX deletion mutant (ΔhtpX) as a negative control to establish baseline measurements in the absence of HtpX activity, which is essential for attributing observed effects specifically to this protease . A complemented strain (ΔhtpX + phtpX) should also be included to confirm that any phenotypes observed in the mutant can be restored by reintroducing the functional gene. When using recombinant HtpX protein for in vitro assays, an enzymatically inactive variant with mutations in the conserved HEXXH motif (typically changing the catalytic glutamate to alanine or glutamine) serves as an essential control to distinguish between specific proteolytic activity and non-specific effects . For assays involving model substrates, researchers should design control substrates with mutations in the putative cleavage sites to confirm cleavage specificity. Additional controls should address potential confounding factors such as growth phase, as Brucella exhibits significant differences in gene expression and invasiveness depending on its growth stage . When investigating potential physiological substrates, quantitative approaches comparing protein levels between wild-type and ΔhtpX strains should include housekeeping proteins as internal controls for normalization. Finally, when using protease inhibitors to confirm metalloprotease activity, appropriate controls with other classes of protease inhibitors should be included to rule out involvement of other proteolytic mechanisms.

What techniques can be used to study the membrane topology of Brucella HtpX?

Studying the membrane topology of Brucella HtpX requires specialized techniques designed for membrane proteins. One widely used approach is the substituted cysteine accessibility method (SCAM), where cysteine residues are introduced at various positions throughout the protein sequence and then tested for accessibility to membrane-impermeable sulfhydryl reagents . This method can help determine which regions of the protein are exposed to the cytoplasm, periplasm, or embedded within the membrane. Protein fusion approaches offer another valuable strategy, where portions of HtpX are fused to reporter proteins such as alkaline phosphatase (PhoA) or green fluorescent protein (GFP), which have different activities depending on their cellular localization . Researchers can also employ protease protection assays, where membrane vesicles containing HtpX are treated with proteases in the presence or absence of detergents, allowing identification of protected (membrane-embedded) regions versus exposed regions. Computational prediction tools specific for membrane proteins should be used to guide experimental design, identifying potential transmembrane segments based on hydrophobicity analysis. For higher-resolution structural information, techniques such as cysteine crosslinking, site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy, or hydrogen-deuterium exchange mass spectrometry can provide detailed insights into membrane protein topology . These approaches are particularly important for Brucella HtpX given the existing controversies about whether its C-terminal hydrophobic regions (H3 and H4) are truly embedded in the membrane, as has been debated for its E. coli homolog.

How can researchers effectively compare HtpX activity across different Brucella species and biotypes?

Effectively comparing HtpX activity across different Brucella species and biotypes requires standardized experimental approaches and careful consideration of genetic and physiological differences. Researchers should first establish a sensitive and reproducible assay system for measuring HtpX protease activity, such as the model substrate approach developed for E. coli HtpX that enables semiquantitative analysis of proteolytic activity . This assay should be adapted for use with multiple Brucella species and validated across different experimental conditions. When comparing HtpX activity, it is essential to account for differences in bacterial growth rates and optimal growth conditions among Brucella species and biotypes, as these factors significantly influence gene expression patterns . Standardization of growth phase is particularly critical, given that invasiveness and associated gene expression profiles vary substantially between logarithmic and stationary growth phases . Quantitative PCR should be used to measure htpX transcript levels across species under identical growth conditions, while Western blot analysis with species-independent antibodies can quantify protein expression levels. For functional comparison, researchers should develop chimeric constructs where htpX genes from different Brucella species are expressed in an identical genetic background (such as a B. melitensis htpX deletion mutant) to directly compare their activities independent of species-specific regulatory differences. Bioinformatic analyses of htpX sequence conservation and variation across Brucella species can provide additional insights into potentially important functional domains and species-specific adaptations.

What statistical approaches are most appropriate for analyzing HtpX expression data in pathogenesis studies?

When analyzing HtpX expression data in pathogenesis studies, researchers should employ statistical approaches that account for the complexity of host-pathogen interactions and biological variability. For comparing htpX expression levels between different experimental conditions (such as growth phases or infection time points), parametric tests like Student's t-test (for two-group comparisons) or Analysis of Variance (ANOVA, for multiple group comparisons) are appropriate when data meet assumptions of normality and equal variance . When these assumptions are not met, non-parametric alternatives such as Mann-Whitney U test or Kruskal-Wallis test should be used. For time-course experiments examining htpX expression during infection, repeated measures ANOVA or mixed-effects models are particularly valuable for accounting for within-subject correlations over time. When correlating htpX expression with bacterial invasion or virulence measurements, regression analyses can identify significant relationships, with multiple regression approaches particularly useful for controlling potential confounding variables . For high-dimensional datasets such as transcriptomics data that include htpX among many genes, approaches like principal component analysis (PCA) or hierarchical clustering can identify patterns of co-regulated genes. Statistical significance should typically be set at p < 0.05, with appropriate corrections for multiple comparisons (such as Bonferroni or false discovery rate methods) when numerous hypotheses are tested simultaneously . Power analyses should be conducted prior to experiments to determine appropriate sample sizes, and biological replicates (typically at least three independent experiments) are essential for robust statistical inference in these complex biological systems.

What bioinformatic tools are most useful for studying the evolutionary conservation of HtpX across Brucella species?

Studying the evolutionary conservation of HtpX across Brucella species requires a suite of complementary bioinformatic tools that address different aspects of sequence, structure, and functional conservation. Sequence alignment tools such as MUSCLE, CLUSTAL Omega, or T-Coffee are essential for basic multiple sequence alignment of htpX genes and protein sequences from diverse Brucella species and biotypes. These alignments serve as the foundation for phylogenetic analysis using methods such as Maximum Likelihood or Bayesian inference implemented in software packages like MEGA, RAxML, or MrBayes, which can reconstruct evolutionary relationships of HtpX proteins within the context of Brucella species evolution. For detecting conserved functional domains and motifs, tools like HMMER or MEME are valuable for identifying signature patterns such as the zinc-binding HEXXH motif characteristic of M48 family proteases . Structural bioinformatics approaches, including homology modeling using tools like SWISS-MODEL or Phyre2, can predict three-dimensional structures of HtpX variants and highlight conservation patterns in tertiary structure that might not be apparent from sequence analysis alone. Membrane topology prediction tools such as TMHMM, TOPCONS, or CCTOP are particularly important for membrane proteins like HtpX to compare predicted transmembrane segments across species. Selection pressure analysis using tools like PAML or HyPhy can identify sites under positive, neutral, or purifying selection, potentially highlighting functionally important regions. Comparative genomics approaches examining synteny and gene neighborhood conservation using platforms like MicrobesOnline or PATRIC provide context for htpX evolution within the Brucella genome.

How can understanding HtpX function contribute to the development of new therapeutic approaches for brucellosis?

Understanding HtpX function in Brucella can significantly contribute to developing novel therapeutic approaches for brucellosis through several mechanisms. As a membrane-bound zinc metalloproteinase involved in protein quality control, HtpX represents a potential drug target with several advantageous characteristics: it is accessible at the bacterial membrane interface, possesses enzymatic activity that can be inhibited by small molecules, and might be essential for bacterial stress adaptation during infection . If HtpX is confirmed to play a crucial role in Brucella virulence or survival within host cells, specific inhibitors targeting its proteolytic activity could be developed as potential anti-brucellosis agents. The development of in vivo assay systems for measuring HtpX activity, similar to those established for E. coli HtpX, provides valuable tools for high-throughput screening of chemical libraries to identify inhibitor candidates . Furthermore, understanding the structural features of HtpX, particularly its active site architecture, enables structure-based drug design approaches to develop highly specific inhibitors with minimal off-target effects on host proteases. Beyond direct inhibition strategies, identifying the physiological substrates of HtpX could reveal downstream pathways critical for Brucella pathogenesis that might themselves present additional therapeutic targets. Research has shown that bacteria in the late logarithmic growth phase, which exhibit the highest invasiveness to epithelial cells, have distinct gene expression profiles that likely include genes involved in membrane homeostasis like htpX . This understanding of growth phase-specific expression patterns can guide the development of therapeutic strategies targeting bacteria at their most virulent stages.

What role might HtpX play in Brucella's response to antibiotic treatment and development of resistance?

HtpX may play a significant role in Brucella's response to antibiotic treatment and the development of resistance through its function in membrane protein quality control. As a membrane-bound zinc metalloproteinase involved in eliminating malfolded or damaged membrane proteins, HtpX likely contributes to maintaining membrane integrity under stress conditions, including antibiotic exposure . Studies with homologous proteins in other bacteria have shown that some bacterial HtpX homologs are specifically induced by membrane damage caused by aminoglycoside antibiotics, suggesting a protective role against antibiotic-induced stress . This protective function might be particularly relevant for Brucella, which must maintain membrane homeostasis during both antibiotic exposure and the harsh conditions encountered within host cells. The potential role of HtpX in antibiotic resistance might involve several mechanisms, including the degradation of damaged membrane proteins that could otherwise compromise bacterial viability, the processing of specific membrane transporters involved in antibiotic efflux or import, or contributions to membrane remodeling that alters permeability to antibiotics. Researchers investigating this relationship should design experiments comparing the antibiotic susceptibility profiles of wild-type and htpX-deficient Brucella strains across different classes of antibiotics, with particular attention to those targeting cell envelope biosynthesis or function. Time-course studies examining htpX expression following antibiotic exposure would provide insights into its regulatory response, while proteomic analyses comparing membrane protein composition between wild-type and mutant strains under antibiotic stress could identify potential HtpX substrates relevant to resistance mechanisms.

How can researchers incorporate HtpX studies into broader investigations of host-pathogen interactions in Brucella infection?

Researchers can effectively incorporate HtpX studies into broader investigations of host-pathogen interactions by adopting integrated experimental approaches that connect molecular mechanisms to cellular and organismal phenotypes. One powerful strategy involves combining transcriptomic analyses of both pathogen and host during infection to correlate htpX expression with specific host responses . Such dual RNA-seq approaches can reveal temporal relationships between htpX activation and changes in host gene expression related to inflammation, cellular stress, or antimicrobial defense. Microscopy-based techniques, including super-resolution approaches coupled with fluorescently tagged HtpX or its substrates, can provide spatial information about protein localization during different stages of the infection process. To understand the significance of HtpX in the context of other virulence factors, researchers should develop multiparameter experiments comparing ΔhtpX mutants with other virulence gene mutants across various infection models, potentially revealing synergistic relationships or redundant pathways. Cell culture infection models using different host cell types (epithelial cells, macrophages, dendritic cells) can provide insights into cell type-specific roles of HtpX in Brucella's intracellular lifestyle . For translational relevance, studies examining htpX expression in clinical isolates with varying virulence or antibiotic resistance profiles could connect basic mechanisms to clinical outcomes. Additionally, research exploring how environmental signals encountered during infection (pH changes, nutrient limitation, oxidative stress) regulate htpX expression and activity would provide context for its role in adaptation to the host environment. Throughout these integrated approaches, it remains essential to distinguish between correlation and causation through rigorous genetic and biochemical validation of hypothesized mechanisms.

What are the methodological challenges in studying membrane proteases like HtpX in Brucella and how can they be overcome?

Studying membrane proteases like HtpX in Brucella presents several methodological challenges that require specialized approaches for successful investigation. One fundamental challenge is the difficulty in expressing and purifying functional membrane proteins while maintaining their native conformation and activity. This can be addressed by optimizing expression systems (such as E. coli strains designed for membrane protein expression), using appropriate detergents for solubilization, and employing gentle purification methods that preserve protein structure . Another significant challenge is developing sensitive assays for measuring proteolytic activity of membrane-bound enzymes like HtpX. Researchers can overcome this by designing model substrates specifically tailored for HtpX, similar to the XMS1 substrate developed for E. coli HtpX, which allows for semiquantitative analysis of proteolytic activity in both in vivo and in vitro systems . Identifying physiological substrates represents another major challenge, as protease-substrate interactions are often transient. This can be addressed through approaches combining crosslinking techniques with mass spectrometry-based proteomics, or by using catalytically inactive "substrate-trapping" HtpX variants to stabilize enzyme-substrate complexes . For genetic manipulation of Brucella, which can be more challenging than model organisms like E. coli, researchers should utilize optimized transformation protocols and consider newer genome editing technologies like CRISPR-Cas9 for precise genetic modifications. The biosafety requirements for working with Brucella species (BSL-3 for most species) present logistical challenges that can be partially mitigated by developing validated surrogate systems in related but less pathogenic alphaproteobacteria for initial studies, before confirming key findings in actual Brucella species.

What is the comparative expression data for htpX across different growth phases of Brucella?

While the search results don't provide specific quantitative data for htpX expression across different growth phases, they do provide valuable information about growth phase-dependent gene expression in Brucella that can inform our understanding of potential htpX regulation patterns. The table below summarizes growth characteristics and invasion efficiency of B. melitensis at different growth phases:

What structural features distinguish Brucella HtpX from homologs in other bacterial species?

The structural features of Brucella HtpX share fundamental similarities with homologs in other bacterial species while potentially possessing unique characteristics related to its specific function in this pathogen. The table below compares key structural features between Brucella abortus HtpX and the well-studied E. coli homolog:

The complete amino acid sequence of Brucella abortus HtpX reveals a protein with multiple hydrophobic regions consistent with its membrane localization: "MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQEVDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLSPEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTLLAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEHNPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNSGPWGQRSDNAGGNSNGGSRYRGPWS" . Detailed comparative structural analysis between Brucella HtpX and homologs from other species would require additional experimental data, particularly regarding the precise membrane topology and three-dimensional structure of these proteins. Such information could reveal species-specific adaptations that might be relevant to Brucella pathogenesis or potential targets for species-specific inhibitors.

What experimental protocols have been validated for studying HtpX activity in Brucella species?

While the search results don't provide Brucella-specific protocols for studying HtpX activity, they do describe validated approaches for studying the E. coli homolog that can be adapted for Brucella research. The table below outlines key experimental protocols that could be adapted for studying HtpX activity in Brucella species:

To develop Brucella-specific protocols, researchers should first clone and express the Brucella htpX gene using expression systems validated for membrane proteins. The XMS1 model substrate approach described for E. coli HtpX provides a valuable template that can be adapted by incorporating potential Brucella-specific cleavage sites . For in vivo studies, biosafety considerations for Brucella require appropriate containment facilities (BSL-3 for most species). Researchers should validate these adapted protocols specifically for Brucella by demonstrating that the observed proteolytic activity is dependent on HtpX expression and abolished by mutations in the conserved active site or by metalloprotease inhibitors that target the zinc-binding site.

What is the correlation between HtpX expression and bacterial survival under different stress conditions?

The most direct evidence from the search results suggests that some bacterial HtpX homologs are specifically induced by membrane damage caused by aminoglycoside antibiotics, suggesting a protective role against this particular stressor . Additionally, the growth phase-dependent variation in gene expression observed in B. melitensis, with distinct patterns between late-log (highly invasive) and stationary phase (less invasive) cultures, suggests potential regulation of membrane protein quality control mechanisms like HtpX in response to changing environmental conditions . Researchers should design targeted experiments to measure htpX expression and HtpX protein levels under various stress conditions relevant to Brucella's lifecycle, particularly those encountered during host infection, and correlate these measurements with bacterial survival rates under the same conditions.