Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074) is a full-length, His-tagged recombinant protein derived from Brucella melitensis, a zoonotic pathogen causing brucellosis. It belongs to the UPF0283 family of uncharacterized membrane proteins, with no confirmed biological function but potential roles in bacterial membrane processes or pathogenesis. The protein is expressed in E. coli and purified to >90% purity, making it suitable for immunological and structural studies .

Comparative Analysis with Other Brucella Membrane Proteins

ProteinKey FeaturesImmunological Relevance
BMEA_A1074UPF0283 family; uncharacterized function; His-tagged.Potential vaccine target; requires functional studies.
Omp3131-kDa outer membrane protein; induces CD4+ T-cell responses and protection.Effective in subunit vaccines; Th1 response mediator .
Omp10/Omp28Fusion proteins with L7/L12 ribosomal proteins; enhance antibody and T-cell responses.Used in adjuvanted vaccine formulations .

Research Findings and Immunological Relevance

While no direct studies on BMEA_A1074 exist in the provided sources, insights from related proteins highlight its potential:

  • Immune Activation: Recombinant Brucella proteins (e.g., Omp31) elicit robust IgG responses and cytotoxic T-cell activity, critical for controlling intracellular infections .

  • Adjuvant Synergy: Combining antigens like Omp10-Omp28-L7/L12 with adjuvants (e.g., TPPPS) enhances immunogenicity, a strategy applicable to BMEA_A1074 .

  • Structural Studies: Techniques like cryo-EM or X-ray crystallography could resolve BMEA_A1074’s structure, aiding in epitope mapping or drug design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BMEA_A1074; UPF0283 membrane protein BMEA_A1074
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella melitensis biotype 2 (strain ATCC 23457)
Target Names
BMEA_A1074
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLESLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVMQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BMEA_A1074 and why is it significant in Brucella melitensis research?

BMEA_A1074 is a membrane protein belonging to the UPF0283 family found in Brucella melitensis biotype 2. The significance of this protein stems from its location within the bacterial membrane, suggesting potential roles in pathogen-host interactions, virulence, and survival within host cells. As a membrane protein, it may contribute to the bacterium's ability to evade immune responses and survive antibiotic treatment, similar to other Brucella species that have demonstrated intracellular survival following antibiotic exposure .

Methodological approach: Researchers typically begin by conducting comparative genomic analyses across Brucella species to identify conserved membrane proteins, followed by bioinformatic prediction of protein structure and function. Experimental validation through knockout studies can then assess the protein's contribution to bacterial survival and virulence.

How can I express full-length recombinant BMEA_A1074 protein?

Expression of full-length membrane proteins presents significant challenges due to their hydrophobic nature and complex folding requirements. For BMEA_A1074, researchers must consider:

Methodological approach:

  • Expression system selection: While E. coli systems are commonly used, membrane proteins often require eukaryotic expression systems such as yeast, insect cells, or mammalian cells to ensure proper folding and post-translational modifications .

  • Vector design: Use vectors containing fusion tags on both N and C termini to distinguish full-length proteins from truncated products.

  • Codon optimization: Analyze the protein sequence and optimize codons for the selected expression system to overcome potential translation issues with rare codons.

  • Solubilization strategy: Employ detergents or nanodiscs to maintain protein stability during extraction from membranes.

Expression SystemAdvantagesDisadvantagesRecommended for BMEA_A1074
E. coliFast growth, high yield, cost-effectiveLimited post-translational modifications, challenges with membrane proteinsInitial screening only
YeastEukaryotic processing, moderate costLonger processing timeYes, for functional studies
Insect cellsGood for complex proteins, proper foldingHigher cost, specialized equipmentYes, for structural studies
Mammalian cellsNative-like environment, proper modificationsHighest cost, longest processing timeFor interaction studies with host proteins

How does BMEA_A1074 contribute to Brucella melitensis pathogenesis and antibiotic resistance?

Understanding the role of BMEA_A1074 in pathogenesis requires sophisticated experimental approaches that examine multiple aspects of bacterial-host interactions.

Methodological approach:

  • Generate knockout and complemented strains of B. melitensis lacking BMEA_A1074

  • Assess intracellular survival within macrophages and other relevant cell types

  • Evaluate antibiotic susceptibility profiles of wild-type versus knockout strains

  • Conduct transcriptomic and proteomic analyses to identify pathways affected by protein deletion

  • Use in vivo infection models to determine virulence attenuation

Research on related Brucella species has demonstrated that some membrane proteins contribute to creating intracellular reservoirs protected from antibiotic action. For instance, Brucella abortus (a related species) has shown the ability to survive antibiotic treatment in in-vitro infection models, with the surviving bacteria found intracellularly . Similar mechanisms may exist for B. melitensis involving membrane proteins like BMEA_A1074.

What structural features of BMEA_A1074 are essential for its function?

Methodological approach:

  • Perform computational structure prediction using AI-based tools like AlphaFold2

  • Validate predictions through experimental techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for specific domains

  • Conduct site-directed mutagenesis of conserved residues

  • Assess functional consequences of mutations through:

    • Protein-protein interaction assays

    • Bacterial survival assays

    • Membrane localization studies

The advancing capabilities of protein structure prediction technologies may help overcome the traditional challenges of determining membrane protein structures . This approach is particularly valuable for proteins like BMEA_A1074 where experimental structural determination remains challenging.

What purification strategies work best for recombinant BMEA_A1074?

Methodological approach:

  • Membrane fraction isolation: Use differential centrifugation to separate bacterial membranes

  • Detergent screening: Test multiple detergents for optimal solubilization:

    • Mild detergents (DDM, LMNG)

    • Zwitterionic detergents (CHAPS, FC-12)

    • Specialized lipid-based systems (nanodiscs, SMALPs)

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) with step gradients of imidazole to separate full-length from truncated proteins

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

How can I assess the interaction of BMEA_A1074 with host cell receptors?

Methodological approach:

  • Protein-protein interaction screening:

    • Yeast two-hybrid assays (modified for membrane proteins)

    • Pull-down assays using recombinant BMEA_A1074 as bait

    • Co-immunoprecipitation studies similar to those used in other protein interaction studies

  • Validation of interactions:

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

    • FRET/BRET assays for in vivo interaction

  • Functional consequences:

    • Receptor blocking studies

    • Signaling pathway analysis

    • Competitive binding assays

These approaches can help identify how BMEA_A1074 might interact with host cell components, potentially revealing mechanisms similar to those observed in other protein-protein interaction studies, such as the TSHR-CD40 interaction demonstrated through co-immunoprecipitation in other research contexts .

How should I interpret conflicting results from different expression systems for BMEA_A1074?

Methodological approach:

  • Systematic comparison: Create a standardized assessment framework comparing:

    • Expression levels

    • Protein folding quality (circular dichroism)

    • Functional activity in relevant assays

    • Post-translational modifications

  • Context-specific validation: Determine which system best represents the native bacterial environment

  • Integrated analysis: Consider that different expression systems may reveal different aspects of protein function

When working with membrane proteins like BMEA_A1074, conflicting results often stem from system-specific effects on protein folding and modification. The methodological solution is to use multiple systems in parallel and integrate findings rather than relying on a single expression approach.

What statistical approaches are appropriate for analyzing BMEA_A1074 interaction data?

Methodological approach:

  • Appropriate controls:

    • Include negative controls (irrelevant membrane proteins)

    • Use scrambled peptides as specificity controls

    • Include positive controls when available

  • Statistical methods:

    • Non-parametric tests for binding assays (Mann-Whitney U test)

    • Multiple comparison correction (Bonferroni or FDR)

    • Curve fitting for kinetic analyses (assess goodness of fit)

  • Data visualization:

    • Forest plots for comparing multiple interaction partners

    • Heat maps for comprehensive interaction screens

    • Network diagrams for placing interactions in biological context

How can BMEA_A1074 research contribute to developing new treatments for brucellosis?

Methodological approach:

  • Target validation:

    • Determine essentiality of BMEA_A1074 for bacterial survival

    • Assess conservation across Brucella strains

    • Evaluate accessibility for drug targeting

  • Drug discovery pathways:

    • Structure-based virtual screening against predicted protein structure

    • Fragment-based screening using biophysical methods

    • Repurposing screens of approved drugs

  • Validation in disease models:

    • Cell-based infection models

    • Animal models of acute and chronic brucellosis

The high relapse rate (5-15%) of brucellosis despite antibiotic therapy underscores the need for new therapeutic approaches. Membrane proteins like BMEA_A1074 represent potential targets for addressing the challenges of intracellular bacterial reservoirs that contribute to treatment failure.

What ethical considerations should be addressed when designing experiments with recombinant Brucella proteins?

Methodological approach:

  • Biosafety assessment:

    • Implement appropriate biosafety level protocols (BSL-3 for live Brucella)

    • Use attenuated strains when possible

    • Consider recombinant protein expression in non-pathogenic hosts

  • Ethical approval process:

    • Institutional biosafety committee review

    • Animal ethics committee approval for in vivo studies

    • Patient consent for clinical samples

  • Responsible research practices:

    • Data sharing according to FAIR principles

    • Transparent reporting of methods and results

    • Consideration of dual-use research concerns

How might single-cell techniques advance our understanding of BMEA_A1074 in host-pathogen interactions?

Methodological approach:

  • Single-cell technologies application:

    • Single-cell RNA-seq of infected host cells

    • Single-cell proteomics to track host response

    • Live-cell imaging with fluorescently tagged BMEA_A1074

  • Integration with spatial information:

    • Spatial transcriptomics of infected tissues

    • Super-resolution microscopy of protein localization

    • Correlative light and electron microscopy

  • Computational analysis:

    • Trajectory inference to track infection progression

    • Network analysis of host-pathogen interactions

    • Machine learning for phenotype prediction

The development of in-vitro models that recapitulate critical elements of chronic infection, such as those being developed for B. melitensis in the human placenta , could be powerful platforms for applying these single-cell approaches.

What are the prospects for using BMEA_A1074 in vaccine development against brucellosis?

Methodological approach:

  • Antigenicity assessment:

    • Epitope prediction and validation

    • T-cell activation assays

    • B-cell response measurement

  • Vaccine platform selection:

    • Recombinant protein subunit vaccines

    • DNA vaccines encoding BMEA_A1074

    • Bacterial vector expressing BMEA_A1074

  • Efficacy and safety testing:

    • Challenge studies in appropriate animal models

    • Immunogenicity in diverse genetic backgrounds

    • Safety assessment in pregnant animals (key concern for brucellosis)

Given the endemic nature of brucellosis in regions like southern Europe and the Middle East , vaccine development represents an important preventive strategy alongside improved therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.