Recombinant Brucella ovis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; BOV_0334; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFMIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links

KEGG: bov:BOV_0334

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of B. ovis MscL differ from other bacterial mechanosensitive channels?

While the search results don't provide specific structural differences between B. ovis MscL and other bacterial MscL homologs, researchers should consider the following methodological approach to analyzing structural differences:

  • Sequence alignment analysis: Compare the amino acid sequence of B. ovis MscL with well-characterized MscL proteins such as those from E. coli using tools like BLAST, Clustal Omega, or MUSCLE.

  • Structural prediction: Use homology modeling software (e.g., SWISS-MODEL, I-TASSER) to generate 3D structural models based on crystallographic data from related MscL proteins.

  • Functional domain comparison: Analyze the conservation of key functional domains, particularly the transmembrane regions and the cytoplasmic helical bundle that contributes to channel gating.

  • Lipid interaction analysis: Examine potential differences in the hydrophobic matching between the protein and membrane that might affect channel sensitivity to membrane tension.

What are the optimal expression systems for producing recombinant B. ovis MscL?

Based on available information, E. coli is the preferred expression system for recombinant B. ovis MscL production . The methodological approach includes:

  • Vector selection: Plasmids with strong, inducible promoters (e.g., T7 promoter in pET systems) are typically used. His-tagging at the N-terminus facilitates purification while maintaining protein functionality .

  • Expression conditions:

    • Bacterial strain: BL21(DE3) or similar expression strains

    • Induction: IPTG (concentration optimization required)

    • Temperature: Lower temperatures (16-25°C) often improve proper folding of membrane proteins

    • Duration: 4-16 hours post-induction (requires optimization)

  • Membrane fraction isolation: Since MscL is a membrane protein, proper isolation of the membrane fraction is crucial, typically involving cell disruption followed by differential centrifugation .

  • Solubilization: Detergent selection is critical, with commonly used options including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or CHAPS. Optimization of detergent concentration is necessary to maintain protein structure and function.

Commercially available recombinant B. ovis MscL products are typically expressed in E. coli systems with N-terminal His-tags .

What purification strategies yield functional recombinant B. ovis MscL?

Purification of functional recombinant B. ovis MscL requires specific approaches due to its membrane protein nature:

  • Affinity chromatography: Ni-NTA affinity chromatography is commonly used for His-tagged recombinant MscL. Critical parameters include:

    • Buffer composition: Typically Tris-based with 6% trehalose at pH 8.0

    • Detergent maintenance: Throughout purification to prevent protein aggregation

    • Elution conditions: Imidazole gradient (20-250 mM)

  • Size exclusion chromatography: Often used as a second purification step to ensure homogeneity and remove aggregates.

  • Reconstitution into liposomes: For functional studies, purified MscL can be reconstituted into liposomes with defined lipid composition.

  • Quality control assessments:

    • SDS-PAGE for purity evaluation (>90% purity is typically achieved)

    • Western blotting for identity confirmation

    • Circular dichroism to verify secondary structure

    • Patch-clamp electrophysiology to confirm channel functionality

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week .

What is the immunogenic potential of recombinant B. ovis MscL compared to other Brucella outer membrane proteins?

While the search results don't specifically address the immunogenicity of B. ovis MscL, they provide substantial information about other outer membrane proteins (OMPs) that allows for methodological comparison:

  • Comparative immunogenicity assessment: Research on Brucella OMPs, particularly Omp31 and Omp25, has shown significant immunogenic potential. For example, recombinant Omp31 (rOmp31) from B. melitensis induces vigorous immunoglobulin G (IgG) responses, with higher IgG1 than IgG2 titers when administered with adjuvants . Researchers should design experiments that compare the antibody responses elicited by recombinant MscL versus these well-characterized OMPs using similar immunization protocols.

  • T-cell response analysis: rOmp31 stimulates specific cellular immune responses, including CD4+ T cells that secrete IL-2 and IFN-γ, and CD8+ T cells that induce cytotoxic-T-lymphocyte activity . Similar analyses should be conducted for MscL:

    • In vitro T-cell stimulation assays

    • Cytokine profiling (particularly Th1 vs. Th2 response patterns)

    • Cell subset depletion studies to determine which T-cell populations are critical

  • Epitope mapping: Identifying immunodominant epitopes within MscL would be valuable. For Omp31, a peptide containing amino acids 48-74 has demonstrated protection without eliciting a specific humoral response . Similar epitope mapping strategies should be applied to MscL.

  • Cross-protection potential: MscL's potential for cross-protection against different Brucella species should be evaluated, similar to studies showing that rOmp31 from B. melitensis provides protection against both B. melitensis and B. ovis infections .

How can recombinant B. ovis MscL be evaluated as a potential vaccine candidate?

The evaluation of recombinant B. ovis MscL as a vaccine candidate should follow a systematic approach:

  • Animal model selection and immunization protocols:

    • BALB/c mice are commonly used for initial vaccine studies

    • Different formulations should be tested (protein alone, with adjuvants, encapsulated)

    • Immunization routes: Intraperitoneal, subcutaneous, or intradermal

    • Multiple immunization schedules (prime-boost strategies)

  • Immune response characterization:

    • Humoral immunity: Serum antibodies can be detected using Western blotting with B. ovis whole-cell lysates and ELISA with purified antigens

    • Cellular immunity: Evaluation of IFN-γ, IL-2, IL-4, and IL-10 production by splenocytes after in vitro stimulation with the recombinant protein

    • Cytotoxic T-lymphocyte activity assessment

  • Challenge studies:

    • Mice are challenged with virulent B. ovis (typically strain PA)

    • Protection is evaluated by comparing bacterial loads in spleens between vaccinated and unvaccinated mice

    • A significantly lower number of B. ovis colony-forming units in spleens relative to unimmunized controls indicates protection

  • Comparison with established vaccines:

    • B. melitensis Rev1 is considered the best available vaccine against B. ovis and should be used as a positive control

    • Other recombinant protein vaccines (e.g., based on Omp31) should be included for comparison

Based on studies with other recombinant Brucella proteins, expected protection levels can be quantified by bacterial load reduction in the spleen, with 1-log10 to 2-log10 reductions considered significant .

What adjuvant systems are most effective for B. ovis MscL-based vaccine formulations?

While the search results don't specifically address adjuvants for B. ovis MscL, they provide insights from other Brucella recombinant protein vaccine studies:

  • Traditional adjuvants:

    • Incomplete Freund's adjuvant has been effective with recombinant Omp31

    • Complete Freund's adjuvant is often used for primary immunization, followed by incomplete Freund's adjuvant for boosters

  • Modern adjuvant systems:

    • CpG-ODN has demonstrated effectiveness with recombinant BP26 protein, inducing M1 macrophage polarization and stimulating cellular immune responses mediated by Th1 cells and CD8+ T cells

    • Aluminum salts may enhance antibody responses but might not adequately stimulate cell-mediated immunity

  • Delivery systems:

    • Encapsulation strategies: Studies with B. ovis ∆abcBA have shown that encapsulation with alginate, or alginate plus vitelline protein B (VpB), can enhance protection against experimental challenge

    • Microparticle or nanoparticle formulations can provide sustained antigen release and improved immunogenicity

  • Adjuvant selection criteria:

    • Ability to stimulate Th1-type responses (critical for Brucella protection)

    • Safety profile for potential veterinary applications

    • Stability in combination with the recombinant protein

    • Compatibility with mass vaccination programs

How can recombinant B. ovis MscL be utilized in serological diagnostic assays?

The development of diagnostic assays using recombinant B. ovis MscL would follow similar methodologies to those established for other Brucella outer membrane proteins:

  • Indirect ELISA development:

    • Optimize coating conditions for recombinant MscL through checkerboard titration experiments

    • Determine appropriate serum dilutions and secondary antibody concentrations

    • Establish cut-off values using known positive and negative control sera

    • Validate with field samples

Based on studies with Brucella recombinant Omp25 and Omp31, optimal coating concentrations might range from 5-10 μg/ml with serum dilutions between 1:10 and 1:80, but these parameters require optimization for each specific protein .

  • Comparative diagnostic performance evaluation:

    • Sensitivity and specificity analysis compared to gold standard methods

    • Cross-reactivity assessment with antibodies against other pathogens

    • Ability to differentiate vaccinated from infected animals

  • Multiplex diagnostic approaches:

    • Combining MscL with other recombinant Brucella antigens such as Omp25 and Omp31 may improve diagnostic accuracy

    • This approach could help differentiate between B. ovis and B. melitensis infections, as demonstrated with Omp25 and Omp31

What experimental considerations are important when developing B. ovis MscL-based diagnostic tests?

Researchers should consider several key factors when developing diagnostic assays based on recombinant B. ovis MscL:

  • Protein preparation considerations:

    • Ensure consistent and reproducible recombinant protein production

    • Verify proper folding of the recombinant protein to maintain conformational epitopes

    • Standardize protein purity (>90%) to minimize background reactions

  • Assay optimization and validation:

    • Determine optimal blocking agents to minimize non-specific binding

    • Evaluate buffer compositions for sample dilution and washing steps

    • Perform ROC curve analysis to establish optimal cut-off values

    • Include appropriate positive and negative controls in each assay

  • Field validation challenges:

    • Test samples from different geographical regions to account for strain variations

    • Include samples from animals with cross-reacting antibodies to assess specificity

    • Compare results with established diagnostic methods (RBPT, CFT, PCR)

  • Diagnostic limitations:

    • The antibody response may vary during different stages of infection

    • Not all infected animals develop detectable antibody responses

    • PCR confirmation may be necessary, recognizing that bacteria are not always detected in blood samples

How can heterologous expression of B. ovis MscL in mammalian cells be used for mechanobiology studies?

Heterologous expression of bacterial mechanosensitive channels like MscL in mammalian cells provides unique opportunities for mechanobiology research:

  • Expression system optimization:

    • Selection of appropriate mammalian cell lines (HEK293, CHO, etc.)

    • Vector design with mammalian promoters and appropriate targeting signals

    • Verification of expression using fluorescent protein tags or antibody detection

    • Assessment of proper localization to cellular membranes

  • Functional characterization methodologies:

    • Patch-clamp electrophysiology to measure channel activity in response to membrane tension

    • Fluorescent dye uptake assays to report MscL activation, which can demonstrate that activated MscL can deliver large molecules into the cell

    • Osmotic down-shock experiments to induce membrane tension and trigger MscL gating

  • Mechanotransduction studies:

    • Investigation of MscL activation through localized membrane stress

    • Analysis of interactions with native cytoskeletal components

    • Acoustic tweezing cytometry (ATC) for applying forces to surface integrin receptors, which can generate localized forces that gate MscL

  • Potential applications:

    • Molecular delivery tool for live cells via mechanical stimulus

    • Insights into cell migration and mechanobiology-focused therapies

    • Engineering new mechanical properties and signaling pathways in mammalian cells

Research has demonstrated that expression of E. coli MscL in mammalian cells confers new mechanosensing capabilities, including activation through membrane tension resulting from osmotic down-shock and interactions with native mechanosensory components .

What is the potential role of B. ovis MscL in bacterial pathogenicity and host-pathogen interactions?

Understanding the role of B. ovis MscL in pathogenicity requires consideration of several research approaches:

  • Mechanosensing during infection:

    • Investigate whether MscL senses mechanical forces during host cell invasion

    • Examine potential roles in adapting to changing osmotic environments within host cells

    • Study contribution to bacterial survival under stress conditions encountered during infection

  • Interactions with host immune system:

    • Analyze host immune responses specifically targeting MscL

    • Investigate whether MscL contributes to bacterial evasion of host defenses

    • Characterize transcriptional responses in macrophages exposed to recombinant MscL

  • Genetic approaches:

    • Generate MscL knockout mutants in B. ovis to assess effects on virulence

    • Perform complementation studies to confirm phenotype specificity

    • Consider construction of multiple mutants affecting cell envelope properties

  • Infection model systems:

    • In vitro infection studies using macrophage cell lines (RAW264.7 commonly used)

    • Transcriptome analysis to identify differentially expressed genes in response to B. ovis infection

    • Immunological pathway identification through KEGG and GO functional enrichment analysis

Studies have shown that B. ovis infection of macrophages triggers multiple immunological pathways, including inflammatory response, immune system processes, cytokine activity, and chemokine-mediated signaling . Further research is needed to determine if MscL specifically contributes to these host-pathogen interactions.

How does the genetic context of the mscL gene in B. ovis compare with other Brucella species?

Methodological approaches for comparative genomic analysis of the mscL gene across Brucella species:

  • Genomic context analysis:

    • Identify the chromosomal location of mscL in B. ovis (BOV_0334)

    • Compare with syntenic regions in other Brucella species

    • Analyze flanking genes and potential operonic structures

  • Evolutionary conservation assessment:

    • Multiple sequence alignment of mscL genes across Brucella species and related genera

    • Calculation of sequence conservation and divergence metrics

    • Identification of species-specific variations that might affect function

  • Regulatory element comparison:

    • Analysis of promoter regions and potential transcription factor binding sites

    • Examination of untranslated regions that might affect mRNA stability or translation efficiency

    • Investigation of potential small RNA regulation

  • Expression pattern studies:

    • RT-qPCR to compare mscL expression levels under various conditions

    • RNA-seq analysis to determine co-expressed genes

    • Comparison of expression patterns between B. ovis and other Brucella species during infection

Brucella species share high levels of DNA homology, but B. ovis has an increased number of pseudogenes and insertion sequences compared to zoonotic smooth Brucella strains . Research is needed to determine if mscL expression or genetic context is affected by these species-specific genomic features.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.