Recombinant Brucella ovis Lectin-like protein BA14k (BOV_A0688)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
BOV_A0688; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Target Names
BOV_A0688
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function

This protein exhibits immunoglobulin-binding and hemagglutination properties, and binds to mannose. It is essential for virulence and may play a role in lipopolysaccharide (LPS) biosynthesis or polysaccharide transport.

Database Links
Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Brucella ovis Lectin-like protein BA14k (BOV_A0688)?

Brucella ovis Lectin-like protein BA14k (BOV_A0688) is a bacterial protein found in the pathogen Brucella ovis, identified by the UniProt ID A5VV34 . The mature protein spans amino acids 27-147 of the full sequence, comprising a 121 amino acid polypeptide with characteristic lectin-like properties . This protein belongs to a class of molecules that typically bind carbohydrates and may play roles in bacterial adhesion, host-pathogen interactions, or cellular recognition processes. While the specific biological function remains under investigation, its classification as a lectin-like protein suggests involvement in carbohydrate-binding activities that could be significant for Brucella ovis pathogenesis. Understanding this protein's structure and function provides insights into Brucella infection mechanisms and potential targets for therapeutic intervention.

What expression systems are used for producing Recombinant Brucella ovis Lectin-like protein BA14k?

Recombinant Brucella ovis Lectin-like protein BA14k is typically expressed in Escherichia coli expression systems as evidenced by commercial preparations . This bacterial expression system offers advantages including high protein yields, cost-effectiveness, and established protocols for heterologous protein production. The recombinant protein is commonly produced with an N-terminal histidine tag to facilitate purification through affinity chromatography techniques . The expression construct typically includes the mature protein sequence (amino acids 27-147) rather than the full-length protein, which may help avoid issues related to signal peptide processing . When designing expression studies, researchers should consider codon optimization for E. coli, as bacterial codon usage differs from that of Brucella species. The expression and purification protocols should be optimized to ensure proper folding and minimize inclusion body formation, which can affect protein functionality in downstream applications.

What are the optimal storage conditions for preserving activity of Recombinant Brucella ovis Lectin-like protein BA14k?

The optimal storage conditions for maintaining the stability and activity of Recombinant Brucella ovis Lectin-like protein BA14k involve several important considerations based on standard protein handling practices. The protein is typically supplied as a lyophilized powder or in a storage buffer containing 50% glycerol and Tris-based buffer components . For long-term storage, temperatures of -20°C to -80°C are recommended, with -80°C being preferable for extended periods to minimize degradation and preserve functional activity . Working aliquots should be maintained at 4°C for up to one week to reduce protein damage from repeated freeze-thaw cycles, which can cause protein denaturation and aggregation . When reconstituting lyophilized protein, sterile deionized water should be used to achieve concentrations of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 5-50% for cryoprotection . It is advisable to centrifuge vials briefly before opening to ensure all material is collected at the bottom, and to prepare multiple small aliquots rather than storing the entire preparation in a single container to minimize freeze-thaw damage when accessing the material for experiments.

How might Brucella ovis Lectin-like protein BA14k contribute to bacterial pathogenesis?

The contribution of Brucella ovis Lectin-like protein BA14k to bacterial pathogenesis likely involves complex host-pathogen interactions that remain to be fully elucidated. As a lectin-like protein, BA14k may function in adhesion to host cell surfaces through recognition of specific carbohydrate structures, potentially facilitating the initial stages of Brucella infection . The protein's amino acid sequence contains motifs suggesting potential binding capabilities that could mediate interactions with host glycoproteins or glycolipids during infection processes . Drawing parallels from research on Brucella abortus pathogenesis mechanisms, BA14k may be regulated under stress conditions similar to those controlled by the general stress response (GSR) system, which is known to be critical during chronic infection phases . The GSR in B. abortus regulates genes essential for adaptation to host environments, and if BA14k is similarly regulated, it may contribute to bacterial persistence during chronic infection . Immunological studies suggest that Brucella stress-response proteins can modulate host immune reactions, potentially contributing to the characteristic immune evasion strategies employed by these pathogens, as evidenced by the differential IgG subclass responses observed in infection models .

What experimental approaches can be used to study the function of Recombinant Brucella ovis Lectin-like protein BA14k?

Investigating the function of Recombinant Brucella ovis Lectin-like protein BA14k requires a multi-faceted experimental approach combining biochemical, structural, and cellular techniques. Glycan array screening represents a powerful method to identify potential carbohydrate binding partners of BA14k, providing insights into its lectin-like properties and potential host receptors . Protein-protein interaction studies using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems can reveal binding partners within host cells or bacterial communities, illuminating potential functional networks. Structural characterization through X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy would provide atomic-level insights into BA14k's conformation and binding sites, while circular dichroism spectroscopy can offer information about secondary structure elements under various conditions. Cell-based assays measuring adhesion to different host cell types in the presence or absence of purified BA14k can demonstrate direct involvement in host-pathogen interactions. Complementation studies using BA14k gene knockouts in B. ovis, followed by phenotypic analysis during infection models, would establish the protein's contribution to virulence in vivo. Given the established mouse models for studying Brucella pathogenesis, researchers could adapt protocols similar to those used for B. abortus studies to examine tissue distribution, bacterial burden, and immune responses specifically related to BA14k function .

How does research on Brucella ovis Lectin-like protein BA14k relate to vaccine development strategies?

Research on Brucella ovis Lectin-like protein BA14k has significant implications for vaccine development strategies against brucellosis, particularly in the context of subunit or recombinant vaccine approaches. Understanding BA14k's role in pathogenesis could reveal whether this protein represents a suitable antigen candidate for protective immunity induction, similar to studies conducted with other Brucella proteins . Drawing parallels from research on B. abortus ΔrpoE1 as a live attenuated vaccine candidate, proteins regulated under stress conditions (which might include lectin-like proteins) could contribute to protective immune responses while exhibiting attenuated virulence profiles . The immunological data from B. abortus studies show that attenuated strains can induce protective immunity with reduced pathological consequences, as evidenced by the differences in splenic pathology observed between wild-type and attenuated strain infections (Table 1) . Specific immune parameters that correlate with protection, such as IgG subclass distribution and IFN-γ production, provide valuable benchmarks for evaluating BA14k-based vaccine formulations . The availability of recombinant BA14k protein preparations facilitates multiple vaccine platform investigations, including protein subunit vaccines, DNA vaccines encoding BA14k, or recombinant vector vaccines expressing this antigen. Comprehensive evaluation would require assessment of both humoral and cell-mediated immune responses, as the Th1/Th2 balance appears critical in Brucella immunity, with IgG2a/IgG1 ratios and IFN-γ production serving as key indicators of protective Th1 responses .

What experimental challenges exist in studying the structure-function relationship of BA14k?

Investigating the structure-function relationship of Brucella ovis Lectin-like protein BA14k presents several experimental challenges that require specialized approaches and technical considerations. The protein's relatively small size (121 amino acids in the mature form) may complicate structural analysis techniques such as X-ray crystallography due to potential difficulties in crystallization . The amino acid composition of BA14k, featuring numerous arginine and histidine residues in repetitive motifs, may present challenges for recombinant expression due to codon usage bias when expressed in heterologous systems such as E. coli . Post-translational modifications that might occur in the native bacterial context could be absent in recombinant versions, potentially altering functional properties and complicating structure-function interpretations. The lyophilization process used in commercial preparations may affect protein refolding upon reconstitution, necessitating careful validation of structural integrity before functional studies . Potential oligomerization or aggregation tendencies, particularly after freeze-thaw cycles, could interfere with both structural and functional analyses, requiring optimization of buffer conditions and handling protocols . The lectin-like nature of the protein suggests carbohydrate-binding capabilities, but identifying physiologically relevant binding partners requires sophisticated glycan array technologies and validation in cellular contexts. Structural studies would need to account for potential conformational changes upon ligand binding, possibly requiring comparative analyses of apo and bound forms. These challenges necessitate a comprehensive experimental approach combining complementary techniques to elucidate the relationship between BA14k's structure and its biological function in Brucella pathogenesis.

What purification strategies are most effective for obtaining high-quality Recombinant Brucella ovis Lectin-like protein BA14k?

Obtaining high-quality Recombinant Brucella ovis Lectin-like protein BA14k requires sophisticated purification strategies tailored to its biochemical properties and intended experimental applications. The primary purification approach leverages the N-terminal His-tag commonly incorporated into recombinant constructs, enabling immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins . This initial capture step should be optimized with appropriate imidazole concentrations in washing buffers to minimize non-specific binding while maximizing target protein recovery. Following IMAC purification, size exclusion chromatography represents a valuable secondary purification step to separate monomeric protein from potential aggregates or oligomers, while simultaneously performing buffer exchange to conditions optimal for downstream applications. For studies requiring exceptionally pure preparations, ion exchange chromatography may serve as an additional polishing step, taking advantage of the protein's charge properties at specific pH values. Quality control assessment should include SDS-PAGE analysis to confirm protein purity (>90% is typically acceptable for most applications), Western blotting to verify identity, and dynamic light scattering to evaluate homogeneity and aggregation state . For functional studies, activity assays specific to the protein's lectin-like properties should be developed and standardized, potentially including carbohydrate binding assays or cell adhesion experiments. Researchers should carefully consider buffer composition during purification and storage, as ionic strength, pH, and stabilizing additives can significantly impact protein stability and activity maintenance during experimental timeframes.

What analytical methods can be used to study BA14k interactions with potential binding partners?

Investigating BA14k interactions with potential binding partners requires a diverse arsenal of analytical methods spanning from biophysical techniques to cellular assays. Surface plasmon resonance (SPR) and bio-layer interferometry (BLI) represent powerful approaches for quantifying binding kinetics and affinity parameters (kon, koff, KD) between immobilized BA14k and potential interaction partners in real-time without labeling requirements. Isothermal titration calorimetry (ITC) provides comprehensive thermodynamic profiles of binding interactions, revealing enthalpy, entropy, and stoichiometry parameters that offer insights into the molecular driving forces of complex formation. For carbohydrate binding studies specific to BA14k's lectin-like properties, glycan microarrays enable high-throughput screening against hundreds of structurally diverse carbohydrates, efficiently mapping binding specificity patterns . Microscale thermophoresis (MST) and fluorescence anisotropy measurements offer solution-based approaches for studying interactions with minimal protein consumption, particularly valuable when working with limited sample quantities. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map binding interfaces by identifying regions protected from solvent exchange upon complex formation, providing structural insights even without crystallographic data. Cross-linking mass spectrometry approaches can identify specific residues involved in proximity interactions, generating distance constraints for computational modeling of complexes. Cell-based binding assays using flow cytometry or confocal microscopy with fluorescently labeled BA14k can verify interactions in more physiologically relevant contexts, complementing the in vitro biophysical measurements. Co-immunoprecipitation studies from bacterial or host cell lysates, coupled with mass spectrometry identification, can reveal novel interaction partners in an unbiased manner, generating new hypotheses about BA14k's functional networks in biological systems.

What are the key considerations for developing immunological assays using Recombinant Brucella ovis Lectin-like protein BA14k?

Developing robust immunological assays using Recombinant Brucella ovis Lectin-like protein BA14k requires careful consideration of multiple experimental variables to ensure specificity, sensitivity, and reproducibility. When generating antibodies against BA14k, researchers should consider both polyclonal and monoclonal approaches, with the latter offering greater epitope specificity but requiring more extensive development processes. Immunization protocols should be designed with careful attention to adjuvant selection, as inappropriate adjuvants may generate non-specific responses or alter protein conformation, potentially yielding antibodies that recognize denatured but not native BA14k. For ELISA development, optimization of coating conditions is essential, as the concentration, buffer composition, and incubation parameters significantly impact protein adherence to plates and epitope presentation . Blocking reagents must be thoroughly validated to minimize background without interfering with specific antibody recognition of BA14k epitopes. When designing immunoblotting procedures, consideration of denaturing versus non-denaturing conditions is crucial, as some antibodies may recognize conformational epitopes that are lost under reducing and denaturing conditions. For multiplexed immunoassays or those involving complex samples, cross-reactivity testing against other Brucella proteins or related bacterial antigens is essential to ensure specificity, particularly given the potential conservation of sequences across Brucella species. Researchers studying host immune responses to BA14k should consider both antibody isotypes (including IgG subclasses) and T cell responses, as data from B. abortus studies indicates that protective immunity correlates with specific IgG2a/IgG1 ratios and robust IFN-γ production characteristic of Th1-biased responses .

How does Brucella ovis Lectin-like protein BA14k compare to similar proteins in other Brucella species?

Comparative analysis of Brucella ovis Lectin-like protein BA14k with analogous proteins in other Brucella species provides valuable evolutionary and functional insights. While the search results don't provide direct sequence comparisons between BA14k and other Brucella proteins, we can infer potential relationships based on general Brucella biology. The presence of lectin-like proteins across Brucella species suggests conserved functions in pathogenesis, potentially involving roles in adhesion, immune evasion, or host cell manipulation. Given the high genomic similarity among Brucella species (typically exceeding 90% at the nucleotide level), BA14k likely shares significant sequence homology with orthologs in other species, though species-specific variations may correlate with host preference differences. In B. abortus, the general stress response (GSR) system regulates numerous genes essential for bacterial adaptation during infection, and if BA14k expression is similarly regulated, it may participate in stress adaptation mechanisms conserved across the genus . The regulatory networks controlling expression might exhibit species-specific variations that reflect adaptation to different hosts - B. ovis primarily infects sheep while B. abortus has a broader host range including cattle and humans. Structural motifs identified in BA14k, such as the repeated tyrosine-arginine-histidine (YRH) sequences and glycine-tryptophan rich regions, could represent conserved functional domains present in homologous proteins across the genus . Immunological cross-reactivity studies could reveal whether antibodies raised against BA14k recognize homologous proteins from other Brucella species, providing insights into structural conservation of key epitopes across the genus and potentially identifying broadly protective antigens for multi-species vaccine development.

What role might BA14k play in Brucella ovis compared to stress response proteins in other Brucella species?

The potential role of BA14k in Brucella ovis may parallel aspects of stress response proteins characterized in other Brucella species, though with unique adaptations specific to B. ovis infection biology. In B. abortus, the general stress response (GSR) system regulated by σE1 is critical for bacterial survival during chronic infection phases, suggesting that stress-responsive proteins play key roles in bacterial persistence within host environments . If BA14k functions within stress response networks, it could contribute to B. ovis adaptation to challenging microenvironments encountered during infection, including oxidative stress, nutrient limitation, or pH fluctuations. The specific influence of BA14k on host immune responses may share similarities with GSR-regulated proteins in B. abortus, which affect patterns of immune activation as evidenced by differential IgG subclass responses and distinct histopathological changes in infected tissues . The detailed histopathological comparison presented in Table 1 demonstrates how wild-type versus attenuated B. abortus strains differentially affect splenic architecture, with implications for understanding how stress response proteins modulate host-pathogen interactions . While B. abortus lacking the GSR regulator σE1 (ΔrpoE1) maintains initial infection capabilities but shows attenuation during chronic phases, BA14k might similarly influence persistent infection rather than initial colonization processes in B. ovis . The IgG subclass ratios and IFN-γ production patterns associated with B. abortus infection could serve as valuable comparative benchmarks for investigating BA14k's immunomodulatory effects in B. ovis, particularly regarding the balance between protective Th1 responses and potentially harmful inflammatory damage . Understanding these comparative aspects could inform rational attenuation strategies for live vaccine development against various Brucella species infections.

How can Recombinant Brucella ovis Lectin-like protein BA14k be used in vaccine development research?

Recombinant Brucella ovis Lectin-like protein BA14k offers multiple strategic applications in vaccine development research targeting brucellosis prevention. As a purified recombinant antigen, BA14k can be evaluated as a subunit vaccine component, either alone or in combination with other Brucella immunogens, to stimulate specific protective immune responses without the safety concerns associated with live organisms . The protein's potential role in bacterial pathogenesis, suggested by its lectin-like properties, makes it a logical candidate for inclusion in vaccine formulations targeting virulence factors or adhesion mechanisms . The existing expression and purification protocols for His-tagged recombinant BA14k provide a scalable platform for producing vaccine-grade protein preparations required for preclinical and clinical evaluation phases . Drawing from studies of B. abortus attenuated strains, researchers should assess BA14k's ability to induce balanced Th1/Th2 responses, with particular attention to IgG2a/IgG1 ratios and IFN-γ production, which correlate with protective immunity against Brucella infections . The detailed histopathological comparisons available from B. abortus studies (Table 1) provide valuable benchmarks for evaluating vaccine-induced protection, as effective vaccines should prevent the severe splenic architecture disruption, extramedullary hematopoiesis, and granuloma formation seen during wild-type infection . Beyond conventional vaccine approaches, the well-characterized recombinant BA14k could be incorporated into novel delivery platforms including nanoparticles, virus-like particles, or DNA vaccines encoding the protein, leveraging its defined sequence and production methods . Comprehensive evaluation strategies should include challenge studies in appropriate animal models, with assessment of bacterial burden, pathological changes, and immunological correlates of protection compared to existing vaccine standards.

What are promising directions for future research on the structure-function relationship of BA14k?

Future research exploring the structure-function relationship of Brucella ovis Lectin-like protein BA14k should pursue multiple complementary approaches to comprehensively characterize this protein's role in bacterial pathogenesis. High-resolution structural determination through X-ray crystallography or cryo-electron microscopy represents a foundational goal, potentially revealing binding pockets, functional domains, and structural motifs that could explain the protein's lectin-like properties . Systematic mutagenesis studies targeting the conserved motifs identified in the amino acid sequence—particularly the repeated tyrosine-arginine-histidine (YRH) sequences and glycine-tryptophan rich regions—would help delineate their contributions to protein function and binding specificity . Comprehensive glycan binding profiling using glycan microarrays or similar high-throughput approaches would define BA14k's carbohydrate recognition profile, potentially identifying host receptors relevant to infection processes. In vivo studies using B. ovis strains with BA14k gene deletions, point mutations, or overexpression could establish the protein's contribution to virulence, tissue tropism, and immune evasion in relevant animal models. Single-molecule techniques such as atomic force microscopy or optical tweezers could investigate the mechanical properties of BA14k-ligand interactions, providing insights into adhesion strength and binding dynamics under physiologically relevant conditions. Integration of experimental data with computational approaches—including molecular dynamics simulations and machine learning—could generate predictive models of BA14k function and identify novel inhibitors with therapeutic potential. Collaborative interdisciplinary research combining structural biology, glycobiology, immunology, and microbial pathogenesis would accelerate understanding of this protein's multifaceted roles and potential applications in diagnostics, therapeutics, and vaccines targeting Brucella infections.

What experimental design considerations are critical when using Recombinant BA14k in immunological studies?

When designing immunological studies involving Recombinant Brucella ovis Lectin-like protein BA14k, researchers must address several critical experimental considerations to ensure meaningful and reproducible results. Protein preparation quality represents a fundamental concern, requiring consistent purification protocols that yield preparations with verified structural integrity and minimal endotoxin contamination, which could otherwise confound immunological readouts through TLR4 activation . Researchers must carefully select appropriate animal models for in vivo immunization studies, considering that while BALB/c mice are commonly used for Brucella immunology research, they exhibit Th2-biased responses that may not fully recapitulate the immune dynamics in natural hosts such as sheep . Dosing strategies require optimization of both antigen quantity and administration schedule, as suboptimal protocols may induce tolerance rather than protective immunity or fail to establish durable immunological memory. Adjuvant selection critically influences the immune response profile, with different formulations potentially skewing toward Th1 responses (e.g., CpG, monophosphoryl lipid A) or Th2 responses (e.g., alum), necessitating careful matching to desired outcome measures . Comprehensive immune assessment should include both B and T cell responses, measuring antibody isotypes/subclasses, cytokine profiles (particularly IFN-γ), and cellular responses through techniques such as ELISpot or flow cytometry . Control groups must include appropriate comparators such as other Brucella antigens, irrelevant proteins expressed in the same system, or conventional vaccine strains to contextualize BA14k-specific responses. Cross-reactivity testing is essential to determine whether immune responses against BA14k recognize homologous proteins from other Brucella species or potentially cross-react with host proteins, which could indicate autoimmunity risks. The inclusion of challenge studies with virulent B. ovis provides critical functional validation of any protective immune responses identified in preliminary immunological characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.