LspA belongs to the class of enzymes known as signal peptidase II (SPase II), assigned the Enzyme Commission number EC 3.4.23.36. This classification places it within the family of proteolytic enzymes that specifically cleave signal peptides from bacterial prelipoproteins. The enzyme is also known by several alternative names including bacterial leader peptidase I, lipoprotein signal peptidase, premurein-leader peptidase, prolipoprotein-signal peptidase, and SPase II .
As a lipoprotein signal peptidase, B. ovis lspA plays a crucial role in the maturation of bacterial lipoproteins by catalyzing the cleavage of signal peptides from prelipoproteins. Specifically, it hydrolyzes the peptide bond in the sequence -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, where Xaa is typically a hydrophobic amino acid (preferably leucine), while Yaa (usually alanine or serine) and Zaa (typically glycine or alanine) have small, neutral side chains .
This enzymatic activity occurs after the lipoprotein has been modified by the addition of a diacylglyceryl moiety to the cysteine residue at the cleavage site, a reaction catalyzed by lipoprotein diacylglyceryl transferase. The processing of these lipoproteins is specifically inhibited by globomycin, an antibiotic that acts as a selective inhibitor of lipoprotein signal peptidase activity .
In Brucella species, lspA participates in the processing of several important outer membrane proteins (Omps) that have been identified as lipoproteins, including Omp10, Omp16, and Omp19. These proteins contain bacterial lipoprotein processing sequences in their amino acid structures and partition into the detergent phase after extraction with Triton X-114, confirming their lipoprotein nature .
The processing of these lipoproteins by lspA is essential for their proper localization and function in the bacterial membrane, which in turn affects various aspects of bacterial physiology and virulence. Research has demonstrated that these lipoproteins incorporate radioactive palmitic acid when labeled, further confirming their lipoprotein status and the functional role of lspA in their processing .
Recombinant Brucella ovis lspA is typically produced using bacterial expression systems, with the recombinant protein often incorporating tags to facilitate purification and detection. The specific tag type may vary depending on the production process and intended application .
Commercial preparations of recombinant B. ovis lspA are typically available in quantities of 50 μg, though other quantities may be available upon request. The recombinant protein is supplied in a stabilizing buffer optimized for maintaining its structural integrity and functional activity .
Brucella ovis possesses distinctive cell envelope properties that differentiate it from other Brucella species. Unlike smooth Brucella species that display an O-polysaccharide in their lipopolysaccharide (LPS), B. ovis is naturally rough, lacking this O-polysaccharide component. Despite this difference, B. ovis remains virulent in sheep, its primary host .
Research has shown that the core oligosaccharide of B. ovis LPS plays an essential role in bacterial survival in vivo, with mutations in genes encoding core glycosyltransferases (wadB and wadC) resulting in attenuated strains . This indicates that specific components of the B. ovis cell envelope, potentially including lipoproteins processed by lspA, are critical for full virulence.
Studies on B. ovis outer membrane proteins have revealed that certain combinations of mutations cannot be obtained, suggesting essential roles for these proteins in bacterial viability. For example, mutants lacking both Omp10 and Omp19, or both Omp31 and Omp25, could not be generated, indicating that at least one protein from each pair is required for bacterial survival .
Since several of these outer membrane proteins are lipoproteins that require processing by lspA, this suggests that lspA plays an indirect but critical role in maintaining B. ovis viability and virulence through its enzymatic activity on these essential membrane components.
The importance of cell envelope components in B. ovis virulence makes proteins involved in their processing or assembly, including lspA, potential targets for vaccine development. Research has demonstrated that mutations affecting LPS core structure (wadB and wadC mutants) result in attenuated strains that can protect mice against B. ovis challenge .
Similarly, multiple mutants lacking specific combinations of outer membrane proteins (some of which are processed by lspA) show varying degrees of attenuation in mouse models. For instance, the Δomp31Δcgs and Δomp10Δomp31Δomp25c mutants are highly attenuated at doses of 10^6 colony-forming units per mouse but can establish persistent infections at higher doses .
Table 3: B. ovis Mutants Related to Cell Envelope Components and Their Characteristics
| Mutant | Viability | Attenuation Status | Protection Ability |
|---|---|---|---|
| ΔwadB | Viable | Attenuated in mice | Protects against B. ovis challenge |
| ΔwadC | Viable | Attenuated in mice | Protects against B. ovis challenge |
| ΔwadA | Viable | Minimal effect | Not determined |
| Δomp10Δomp19 | Not viable | Not applicable | Not applicable |
| Δomp31Δomp25 | Not viable | Not applicable | Not applicable |
| Δomp10Δomp31Δomp25c | Viable with defects | Highly attenuated at 10^6 CFU | Not fully determined |
| Δomp31Δcgs | Viable | Highly attenuated at 10^6 CFU | Not fully determined |
Recombinant B. ovis lspA has potential applications in diagnostic testing, particularly in enzyme-linked immunosorbent assays (ELISAs) for detecting antibodies against B. ovis in infected animals. This application leverages the antigenic properties of lspA and its processed lipoproteins to develop specific and sensitive diagnostic tools for B. ovis infection .
Despite the available information on lspA structure and function, several important questions remain unanswered. Further research is needed to fully elucidate:
The complete catalog of lipoproteins processed by lspA in B. ovis
The direct contribution of lspA activity to B. ovis virulence
The potential of lspA itself as a target for antimicrobial development
The immunogenic properties of lspA and its processed lipoproteins
Recent advances in genomic analysis of Brucella species have provided new tools for investigating the role of specific proteins like lspA in bacterial physiology and pathogenesis. Whole-genome sequencing approaches allow for comparative analysis of gene conservation and variation across different Brucella isolates, potentially revealing the evolutionary significance of lspA and related proteins .
Similarly, the application of advanced proteomic techniques may help identify the complete set of lipoproteins processed by lspA in B. ovis, furthering our understanding of its role in bacterial membrane biology and providing new targets for vaccine development.
KEGG: bov:BOV_0144
Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is a critical membrane-embedded enzyme in Gram-negative bacteria responsible for processing prolipoproteins. In Brucella ovis, lspA (gene locus BOV_0144) functions as a membrane protease (EC 3.4.23.36) that specifically cleaves signal peptides from prolipoproteins after lipid modification . This processing is essential for the proper localization and anchoring of mature lipoproteins to the bacterial membrane.
The proper functioning of lspA is particularly important in B. ovis, which is a naturally rough species lacking the O-polysaccharide component of lipopolysaccharide . While smooth Brucella species utilize O-PS as a major virulence factor, B. ovis relies heavily on properly processed outer membrane proteins and lipoproteins for survival within the host and immune evasion. The full amino acid sequence of B. ovis lspA consists of 160 amino acids with multiple transmembrane domains that anchor it within the bacterial membrane while positioning its catalytic site to access prolipoprotein substrates .
Recombinant Brucella ovis lspA aims to reproduce the native enzyme's structure and function while incorporating modifications that facilitate expression, purification, and experimental manipulation. The main differences include:
The recombinant form typically contains affinity tags (such as His-tag) to enable purification, which are not present in the native enzyme. These tags may be incorporated at either the N- or C-terminus, depending on experimental requirements and potential interference with enzyme function . When expressed in heterologous systems like E. coli, recombinant lspA may have slightly different post-translational modifications compared to the native form in B. ovis.
For functionality studies, researchers must carefully evaluate whether the recombinant enzyme maintains proper folding and catalytic activity. This often requires reconstitution in appropriate membrane mimetics (detergent micelles, liposomes, or nanodiscs) to provide the hydrophobic environment necessary for proper structure and function. Despite these differences, well-designed recombinant lspA constructs can serve as excellent models for understanding the native enzyme's properties when proper experimental controls are implemented to validate structural integrity and catalytic competence.
Brucella ovis lspA exhibits several key structural characteristics that define its function as a membrane-embedded protease:
The enzyme consists of multiple transmembrane domains that anchor it within the bacterial membrane. Its 160-amino acid sequence (MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLALFRTHNEGIAFSMLAW LHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVVDYVL FHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH) forms a complex tertiary structure with the catalytic site positioned to access the lipid-modified N-terminus of prolipoproteins .
Like other bacterial signal peptidases, lspA contains a catalytic dyad (rather than the triad found in many proteases) consisting of conserved aspartate and lysine residues that mediate the proteolytic reaction. Studies on LspA conformational dynamics have revealed that the enzyme cycles through at least three distinct conformational states during its catalytic cycle: closed, intermediate, and open . The open conformation is particularly important as it allows prolipoprotein substrates to enter and bind in the active site in the correct orientation for signal peptide cleavage .
Production of functional recombinant Brucella ovis lspA requires specialized approaches due to its membrane-embedded nature. The following methodology represents current best practices:
Expression system selection is critical - bacterial systems like E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression provide better results than standard strains. The lspA gene should be cloned into vectors containing solubility-enhancing fusion partners (MBP, SUMO) and affinity tags (His, FLAG) for purification .
Expression conditions should be carefully optimized, with induction at lower temperatures (16-25°C) and reduced inducer concentrations to prevent aggregation and inclusion body formation. For membrane extraction, mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) effectively solubilize lspA while maintaining its native conformation.
Purification typically involves multi-step chromatography: initial capture via immobilized metal affinity chromatography (IMAC), followed by size exclusion chromatography (SEC) in the presence of stabilizing detergents. For functional studies, reconstitution into lipid nanodiscs or liposomes with E. coli or Brucella-mimicking lipid compositions provides a more native-like membrane environment. Verification of proper folding and activity should be performed using circular dichroism spectroscopy and enzyme activity assays with synthetic prolipoprotein substrates.
Measuring lspA enzymatic activity requires specialized assays that accommodate its membrane-associated nature and specific substrate requirements:
Fluorogenic substrate assays offer the most direct measurement approach. Synthetic prolipoproteins containing FRET (Förster Resonance Energy Transfer) pairs can be designed where the donor and acceptor fluorophores are positioned such that cleavage by lspA results in measurable fluorescence changes. This allows real-time monitoring of enzyme kinetics under various conditions.
Alternative approaches include mass spectrometry-based assays where reaction products from synthetic or natural prolipoprotein substrates are analyzed by LC-MS/MS to identify cleavage sites and quantify reaction progression. For both approaches, optimization of the reaction environment is critical - assays should include appropriate detergents or lipid systems to maintain enzyme structure, and buffer conditions should reflect the acidic environment encountered by Brucella during intracellular infection.
Kinetic parameters (Km, kcat, Vmax) should be determined under standardized conditions to enable comparison between different lspA variants or between lspA from different Brucella species. Control experiments using known signal peptidase inhibitors like globomycin can validate assay specificity, while site-directed mutagenesis of catalytic residues provides additional validation of enzymatic mechanisms.
Effective experimental design for studying lspA function in Brucella requires multi-level approaches that address both molecular mechanisms and biological significance:
At the molecular level, combining structural studies with functional assays provides comprehensive insights. X-ray crystallography or cryo-EM of lspA in different conformational states can be complemented with spectroscopic methods like DEER (Double Electron-Electron Resonance) to measure distances between specific residues during conformational changes . These structural insights should be connected to function through enzyme kinetics and substrate specificity studies.
For cellular and organismal studies, gene knockout and complementation strategies are essential. Construction of lspA deletion mutants in Brucella, followed by phenotypic characterization and complementation with wild-type or site-directed mutants, can establish causality between lspA function and observed phenotypes. The Sequential Multiple Assignment Randomized Trial (SMART) design offers an adaptive intervention approach particularly valuable for optimizing complex experimental protocols with multiple variables .
Infection models using macrophage cell cultures provide insights into intracellular survival and trafficking, while animal models can evaluate virulence and immune responses. For all these approaches, proper controls are essential, including comparison with other Brucella species (smooth vs. naturally rough) and with defined mutants affecting other aspects of outer membrane function, such as BvrS/BvrR regulatory system mutants .
Lipoprotein signal peptidase plays a multifaceted role in Brucella pathogenicity through its impact on outer membrane structure and function:
In naturally rough species like B. ovis, which lack the O-polysaccharide component of LPS, properly processed lipoproteins become particularly crucial for host interaction and immune evasion . While smooth Brucella species use O-PS as a ligand for the scavenger receptor SR-A on host cells, natural rough species like B. ovis utilize outer membrane proteins for this interaction . The proper processing of these proteins by lspA is therefore essential for host cell entry and intracellular survival.
Studies with other genes affecting membrane integrity, such as the BvrS/BvrR two-component regulatory system, have demonstrated that disruption of outer membrane homeostasis leads to increased susceptibility to antimicrobial peptides, complement-mediated killing, and reduced intracellular survival . Given that lspA ensures proper processing of membrane lipoproteins, its function directly impacts these virulence-associated properties.
Interestingly, naturally rough Brucella species have evolved compensatory mechanisms that allow them to maintain resistance to complement and antimicrobial peptides despite lacking O-PS . These compensations likely involve properly processed outer membrane proteins and lipoproteins, highlighting lspA's importance in these species. Research comparing wild-type and lspA-deficient strains in infection models would further illuminate how lipoprotein processing contributes to virulence, intracellular trafficking, and immune evasion.
LspA exhibits complex conformational dynamics essential for its function as a membrane-embedded protease:
Structural and spectroscopic studies have identified at least three distinct conformational states that LspA cycles through: closed, intermediate, and open . The open conformation is particularly critical for substrate binding, as it creates sufficient space for the prolipoprotein to enter and position correctly within the active site. Once the substrate is bound, transitions between these conformational states facilitate the catalytic reaction and product release.
DEER spectroscopy has been used to measure distances between specific residues in LspA, revealing that the enzyme samples all three conformations (closed, intermediate, and open) in multiple states (apo, inhibitor-bound), though the population distribution varies . The multiple distance populations observed and the two-component continuous wave line shape in spectroscopic studies indicate a complex conformational landscape.
These conformational transitions are functionally significant - they control substrate access to the active site, determine the specificity of catalysis, and regulate product release. Understanding these dynamics is crucial for developing inhibitors that could target specific conformational states. For researchers studying lspA, it's important to consider that experimental conditions may influence the conformational equilibrium, potentially explaining variable results across different studies or assay systems.
The relationship between lspA and the BvrS/BvrR two-component regulatory system represents an important but understudied area in Brucella research:
BvrS/BvrR is one of 21 putative two-component regulatory systems identified in the Brucella genome and plays a crucial role in regulating outer membrane homeostasis . Its dysfunction leads to increased surface hydrophobicity, susceptibility to antimicrobial peptides, and attenuation of virulence - phenotypes that would likely also result from lspA dysfunction.
While direct interactions between lspA and BvrS/BvrR have not been extensively characterized, functional connections likely exist as both systems impact outer membrane integrity. BvrS/BvrR regulates the expression of major outer membrane proteins and influences lipopolysaccharide acylation patterns . Since lspA processes lipoproteins destined for the outer membrane, its activity complements BvrS/BvrR-mediated regulation.
Studies on bvrS and bvrR mutants have shown alterations in LPS structure, particularly in lipid A acylation, correlating with increased binding of antimicrobial peptides . This suggests that BvrS/BvrR regulates multiple aspects of outer membrane biogenesis, potentially including lipoprotein processing pathways. To investigate potential interactions, researchers should consider transcriptional analysis to determine if lspA expression is regulated by BvrS/BvrR, proteomic analysis to identify changes in lipoprotein processing in regulatory system mutants, and phenotypic characterization of double mutants affecting both systems.
Naturally rough Brucella species like B. ovis have evolved sophisticated compensatory mechanisms to maintain virulence despite lacking the O-polysaccharide component of LPS:
Unlike rough mutants derived from smooth Brucella strains, which show increased susceptibility to complement and antimicrobial peptides, natural rough species maintain resistance levels similar to or even greater than their smooth counterparts . This suggests the evolution of specific adaptations to compensate for the absence of O-PS as a protective barrier.
These compensatory mechanisms appear to involve modifications to multiple components of the outer membrane. The core oligosaccharide side branch makes significant contributions to complement resistance, while outer membrane proteins (OMPs) likely serve as alternative ligands for host cell receptors . As demonstrated in Figure 2 of search result , natural rough Brucella species use OMPs, including Omp22 and Omp25d, to interact with host scavenger receptors during cell entry, whereas smooth species use O-PS for this purpose.
LspA plays a critical role in these compensations by ensuring the proper processing and localization of lipoproteins that contribute to membrane integrity and host interactions. Properly processed lipoproteins may contribute to the maintenance of outer membrane stability, modification of surface properties to resist complement and antimicrobial peptides, and mediation of specific interactions with host cells during infection. Future research comparing lipoprotein profiles between smooth and naturally rough Brucella species, as well as studies on lspA mutants in B. ovis, would further elucidate these compensatory mechanisms.
When facing contradictory results in lspA studies, researchers should implement a systematic analysis approach:
First, examine experimental conditions meticulously. The membrane-associated nature of lspA makes it particularly sensitive to differences in expression systems, purification methods, and reconstitution environments. Variations in detergent types, lipid compositions, or buffer conditions can significantly impact conformation and activity. The multiple conformational states of lspA (closed, intermediate, and open) further complicate matters, as different experimental conditions may favor different conformational distributions .
Species-specific differences represent another critical factor. Comparative analysis of naturally rough species (B. ovis, B. canis) with smooth species and rough mutants can reveal important distinctions . Natural rough Brucella species have evolved compensatory mechanisms absent in rough mutants, which may lead to seemingly contradictory results when comparing these different strains.
Statistical approaches designed for complex experimental data can help resolve contradictions. The Sequential Multiple Assignment Randomized Trial (SMART) design provides a framework for analyzing multi-stage experimental data and identifying optimal sequences of interventions . When contradictions persist despite careful analysis, they often indicate biologically meaningful complexity rather than experimental error. Such cases warrant deeper investigation into potential strain-specific adaptations, conformational heterogeneity, or context-dependent function of lspA.
Analyzing lspA activity data requires specialized statistical approaches that account for the complexity of membrane protein enzymology:
For more complex experimental designs, particularly those involving multiple stages or adaptive interventions, the SMART framework provides sophisticated statistical tools . These include methods for comparing intervention options at different stages and identifying optimal experimental sequences. Time series analysis is valuable for tracking conformational dynamics or activity changes over time, especially when using continuous monitoring methods like fluorescence-based assays.
Multivariate statistical approaches such as principal component analysis (PCA) or partial least squares (PLS) can identify patterns in complex datasets integrating multiple measurements (activity, structural parameters, membrane properties). When comparing multiple experimental conditions, analysis of variance (ANOVA) with appropriate post-hoc tests accounts for multiple comparisons. For all statistical analyses, sample size calculations based on preliminary data should guide experimental design to ensure sufficient power for detecting biologically meaningful effects.
| Statistical Method | Application in lspA Research | Advantages |
|---|---|---|
| Nonlinear regression | Enzyme kinetics analysis | Provides estimates of Km, Vmax, kcat |
| Mixed-effects models | Multi-experiment data analysis | Accounts for both fixed and random effects |
| SMART framework | Complex, multi-stage experiments | Optimizes adaptive experimental protocols |
| Multivariate statistics | Integration of multiple parameters | Identifies patterns in complex datasets |
| Time series analysis | Conformational dynamics studies | Tracks changes over time with continuous monitoring |
Several cutting-edge technologies hold significant promise for deepening our understanding of lspA function:
Cryo-electron microscopy (cryo-EM) represents a revolutionary advance for membrane protein structural biology, potentially revealing lspA structures in different conformational states at near-atomic resolution without crystallization. This technique could capture the conformational dynamics previously detected through spectroscopic methods . Single-molecule FRET (smFRET) and hydrogen-deuterium exchange mass spectrometry (HDX-MS) offer complementary approaches for monitoring conformational changes in real-time and mapping structural dynamics at the residue level.
CRISPR-Cas9 genome editing enables precise genetic manipulation of Brucella, facilitating the creation of targeted mutations in lspA and related genes with minimal off-target effects. This technology permits construction of reporter strains where lspA activity or conformational states can be monitored in living bacteria during infection.
Innovative membrane mimetics including nanodiscs, styrene-maleic acid lipid particles (SMALPs), and cell-derived membrane vesicles provide more native-like environments for functional studies than traditional detergent systems. These approaches better preserve lateral pressure and lipid composition effects on lspA activity.
Advanced imaging techniques such as super-resolution microscopy and correlative light and electron microscopy (CLEM) can localize lspA within bacterial membranes and track its distribution during infection. These technologies, combined with adaptive experimental designs based on the SMART framework , promise to reveal new insights into lspA function and its contribution to Brucella pathogenesis.
LspA research offers several promising avenues for advancing brucellosis prevention and treatment strategies:
As a conserved bacterial enzyme absent in mammalian cells, lspA represents an attractive target for antimicrobial development. Understanding its conformational dynamics and catalytic mechanism enables structure-based drug design approaches targeting specific conformational states or active site regions. Such inhibitors could disrupt outer membrane biogenesis, potentially attenuating Brucella virulence.
LspA-processed lipoproteins represent promising vaccine antigen candidates, particularly for naturally rough species like B. ovis where these proteins play enhanced roles in host interaction . Comparative proteomic analysis of wild-type and lspA-deficient strains could identify specific lipoproteins that contribute significantly to virulence and immunogenicity.
For live attenuated vaccine development, engineered strains with modified lspA activity could achieve the delicate balance between attenuation and immunogenicity. By calibrating lipoprotein processing to allow sufficient bacterial survival for immune stimulation while preventing full virulence, researchers could develop improved vaccines with enhanced safety profiles.
Additionally, understanding how lspA interacts with regulatory systems like BvrS/BvrR provides insights into bacterial adaptation during infection, potentially revealing new vulnerabilities that could be targeted therapeutically. By disrupting the coordinated regulation of outer membrane homeostasis, combination therapies targeting both lspA and regulatory components could overcome bacterial compensatory mechanisms and achieve more effective clearance.