Recombinant Brucella ovis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; BOV_1746; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFAAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links

KEGG: bov:BOV_1746

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Brucella ovis Protease HtpX homolog and what is its significance in Brucella pathogenesis?

The HtpX homolog in Brucella ovis is a membrane-bound zinc metalloprotease that plays a role in protein quality control and stress response pathways. While not extensively characterized in the provided search results, it belongs to a class of proteases that typically function in membrane protein degradation and cellular homeostasis.

In the context of Brucella pathogenesis, membrane proteins are critical for virulence and host-pathogen interactions. Research has shown that outer membrane proteins (OMPs) like OMP25 and OMP31 are essential for B. ovis survival and infection. For instance, OMP25 is involved in inhibiting macrophage TNF-α production, which is the first cytokine produced during Brucella infection . Similarly, proteases like HtpX may participate in the regulation of membrane protein composition and virulence factor expression.

How does HtpX compare structurally and functionally to other important Brucella ovis membrane proteins?

While the search results don't provide specific structural information about HtpX, we can draw comparisons with well-characterized membrane proteins in B. ovis. Unlike the barrel-shaped outer membrane proteins such as OMP25 and OMP31 that form pores , HtpX is typically a multi-pass transmembrane protease.

Functionally, HtpX likely differs from the outer membrane proteins OMP25 and OMP31, which serve roles in virulence and immune response. OMP31 of B. melitensis (OMP31m) is a 31 kDa pore-forming protein with 240 amino acid residues, having a β-barrel structure based on eight β-strands with a flexible N-terminal region of 48 residues that links to peptidoglycan . OMP25 has a similar three-dimensional structure to OMP31 . In contrast, HtpX would likely function enzymatically to cleave misfolded or damaged membrane proteins as part of quality control mechanisms.

What genomic analysis methods are most effective for studying HtpX and other virulence factors in Brucella species?

For genomic analysis of virulence factors like HtpX in Brucella species, several methodologies have proven effective:

  • Annotation with specialized tools: Prokka (version 1.14.6) can be used for general genome annotation, while EggNOG-mapper (version 2.1.5) provides functional annotation and COG (clusters of orthologous groups) information .

  • Virulence factor identification: The Virulence Factors of Pathogenic Bacteria Database (VFDB) is valuable for identifying virulence factor genes in Brucella genomes .

  • Ortholog identification: OrthoFinder (version 2.5) can identify gene families in the pangenome of Brucella strains, helping to place HtpX in its evolutionary context .

  • Comparative genomics: This approach is particularly useful for distinguishing between classical intracellular, nonclassical intracellular, and extracellular Brucella species, which exhibit differences in phylogenetic relationships .

How can recombinant HtpX be optimally expressed and purified for structural and functional studies?

For optimal expression and purification of recombinant B. ovis HtpX, researchers should consider the following protocol based on successful approaches with other Brucella proteins:

What roles might HtpX play in Brucella ovis survival under stress conditions and host immune evasion?

As a membrane protease homologous to E. coli HtpX, the B. ovis HtpX likely plays crucial roles in stress response and potentially in host immune evasion:

  • Protein quality control: HtpX typically functions in removing misfolded or damaged membrane proteins under stress conditions. This function becomes particularly important when B. ovis faces environmental stresses within the host.

  • Virulence regulation: By analogy with other membrane proteases, HtpX might regulate the abundance or activity of certain virulence factors. Research on other Brucella virulence factors shows that membrane proteins like OMP25 are involved in inhibiting host immune responses, such as macrophage TNF-α production .

  • Stress adaptation: Like other Brucella species, B. ovis must adapt to various stressful environments during infection. The search results indicate that B. ovis has unique biological properties and distinct surface features compared to other Brucella species , which might involve HtpX-mediated adaptations.

  • Intracellular survival: B. ovis belongs to the classical intracellular Brucella species . HtpX might contribute to intracellular survival by helping maintain membrane integrity under the harsh conditions inside host cells.

  • Interaction with host factors: As a membrane-associated protease, HtpX might process host proteins or bacterial surface proteins to modulate host-pathogen interactions.

How do mutations in the htpX gene affect Brucella ovis virulence and host cell interactions compared to mutations in other membrane protein genes?

While the search results don't specifically address HtpX mutations, we can draw parallels from studies on mutations in other B. ovis membrane protein genes:

  • Potential viability impacts: Research on other membrane proteins shows that some combinations of mutations are lethal. For instance, "Mutants lacking Omp10 plus Omp19 could not be obtained, suggesting that at least one of these lipoproteins is required for viability. A similar result was obtained for the double deletion of omp31 and omp25" . HtpX mutations might similarly affect bacterial viability, especially under stress conditions.

  • Host cell interaction effects: Mutations in membrane proteins can significantly impact host-pathogen interactions. For example, "Omp25c (proved essential for internalization in HeLa cells)" . HtpX mutations might similarly affect interactions with host cells, particularly if HtpX processes surface proteins involved in adhesion or invasion.

  • Virulence attenuation: Multiple mutations in membrane protein genes resulted in "important in vitro and in vivo defects" . HtpX mutations might similarly attenuate virulence, potentially providing candidates for vaccine development.

  • Cellular processes: Given HtpX's likely role in protein quality control, mutations might affect multiple cellular processes, leading to complex phenotypes similar to those observed in membrane protein mutants.

  • Compensatory mechanisms: B. ovis showed the ability to "survive to the simultaneous absence of Omp10 and four out seven proteins of the Omp25/Omp31 family" , suggesting compensatory mechanisms exist. Similar adaptations might occur with HtpX mutations.

What are the most effective serological methods for detecting antibodies against recombinant Brucella ovis proteins including HtpX?

Based on successful approaches with other B. ovis recombinant proteins, the following serological methods would be most effective:

  • Indirect ELISA (iELISA): This has proven highly effective for detecting antibodies against recombinant B. ovis proteins. For OMP25o and OMP31m, optimal conditions were determined through checkerboard experiments. The research found that "the optimal coating concentration of Omp25o is 8 μg/ml and the optimal dilution ratio is 1:10," while "the optimal coating concentration of Omp31m is 10 μg/ml and the optimal dilution ratio is 1:80" . Similar optimization would be needed for recombinant HtpX.

  • Protocol optimization: For recombinant proteins, coating conditions are critical. The search results describe a protocol where "96-well plates were coated overnight at room temperature with sonicated bacterial suspensions in PBS (OD 600 = 1)" . For purified recombinant HtpX, direct coating without sonication might be preferable.

  • Antibody detection: The use of appropriate primary and secondary antibodies is essential. Studies with other Brucella proteins used "MAbs (hybridoma supernatant) diluted 1/2 and a goat anti-mouse IgG-horseradish peroxidase conjugate diluted 1:9000" . Similar approaches could be adapted for HtpX.

  • Cut-off determination: Proper determination of cut-off values is crucial for distinguishing positive from negative results. In the referenced studies, negative sera were used to calculate the cut-off values .

  • Validation: As demonstrated with OMP25o and OMP31m, validation against known positive and negative samples is essential. The recombinant proteins showed "completely consistent with the results of the Rose Bengal test" .

What molecular techniques can be employed to study the proteolytic activity and substrate specificity of recombinant HtpX?

To characterize the proteolytic activity and substrate specificity of recombinant HtpX from B. ovis, researchers can employ several molecular techniques:

  • In vitro proteolytic assays: Using fluorogenic or chromogenic peptide substrates with sequences representing potential HtpX cleavage sites. This allows quantitative measurement of enzymatic activity and determination of kinetic parameters.

  • Membrane protein substrate identification:

    • Incubation of purified HtpX with candidate substrate proteins followed by SDS-PAGE analysis to detect cleavage products

    • Mass spectrometry-based approaches to identify cleavage sites in potential substrates

    • Proteomic comparison of wild-type and htpX-deficient B. ovis to identify accumulated substrates

  • Site-directed mutagenesis: Modification of predicted catalytic residues in HtpX to confirm their role in enzymatic activity. As a zinc metalloprotease, mutations in the zinc-binding motif would be particularly informative.

  • Inhibitor profiling: Testing various protease inhibitors (particularly metalloprotease inhibitors) to characterize the catalytic mechanism of HtpX and identify potential selective inhibitors.

  • Substrate specificity determination: Using peptide libraries or phage display techniques to determine the preferred cleavage site sequence motifs for HtpX.

How can gene knockout and complementation studies be designed to elucidate the function of HtpX in Brucella ovis pathogenesis?

Based on successful genetic manipulation studies with other B. ovis genes, the following approaches would be effective for HtpX:

  • Gene deletion strategy: Multiple gene mutagenesis has been successfully applied to B. ovis. The search results describe a method where "single mutants listed in Table 1 were subjected to a second mutagenesis round with a recombinant plasmid containing another inactivated gene" . For HtpX, a similar approach could be used, employing a recombinant plasmid containing an inactivated htpX gene.

  • Mutant verification: "The selection of mutant strains was performed with specific PCRs targeting each inactivated locus" . Similar PCR-based verification should be employed for htpX knockout confirmation.

  • Phenotypic characterization:

    • Growth characteristics assessment in both solid and liquid media

    • Colony size and morphology evaluation

    • Growth curves establishment as described: "Growth curves were established for triplicate bacterial suspensions in TSB-YE-HS medium (30 ml) with initial OD 600 readings of 0.05 that were incubated at 37°C under agitation (120 rpm) and a 5% CO2 atmosphere"

  • Complementation studies: Re-introduction of the functional htpX gene to confirm that observed phenotypes are specifically due to htpX deletion rather than polar effects.

  • Virulence assessment:

    • Cellular models: Using cell lines like HeLa cells to assess internalization capabilities

    • Animal models: Evaluating survival and pathology in appropriate animal models

    • Immune response analysis: Measuring host cytokine responses to wild-type versus htpX mutant strains

  • Genetic interaction studies: Creating double or triple mutants involving htpX and other genes to identify genetic interactions, similar to the multiple mutant studies described in the search results .

How does the structure of HtpX protease compare across different Brucella species, and what implications might these differences have for specificity and function?

Structural comparisons of HtpX across Brucella species would reveal important insights into functional conservation and specialization:

  • Sequence conservation analysis: While not specifically mentioned for HtpX, comparative analysis approaches similar to those used for OMP25 and OMP31 would be valuable. For context, "OMP25 is highly conservative in Brucella species" with "DNA sequence variation is less than 1.9% among different Brucella species" . Analysis of HtpX sequence conservation could reveal similarly high conservation or species-specific variations.

  • Structural modeling: Using approaches similar to those that revealed the β-barrel structure of OMP31 and OMP25 , structural predictions for HtpX across species could identify conserved catalytic domains and variable regions that might affect substrate specificity.

  • Functional implications: Any structural differences in HtpX between classical intracellular Brucella species (like B. ovis), nonclassical intracellular species, and extracellular species might correlate with their different lifestyles and host preferences.

  • Catalytic site conservation: Analysis of the zinc-binding motif and catalytic residues across species would indicate whether the basic proteolytic mechanism is conserved while substrate binding regions might vary.

  • Host adaptation signatures: Comparative genomic analysis methods described in the search results could identify signs of host-adaptive evolution in HtpX sequences, particularly in species with narrow host ranges like B. ovis.

What experimental approaches can determine if HtpX is required for Brucella ovis survival under different stress conditions?

To determine whether HtpX is required for B. ovis survival under different stress conditions, researchers can employ the following experimental approaches:

  • Stress sensitivity assays: Comparing wild-type and htpX mutant strains under various stressors:

    • Oxidative stress (H₂O₂, paraquat)

    • pH stress (acidic and alkaline conditions)

    • Temperature stress (heat shock)

    • Nutrient limitation

    • Host-relevant stressors (nitric oxide, antimicrobial peptides)

  • Growth curve analysis: Similar to the approach described for other B. ovis mutants: "Growth curves were established for triplicate bacterial suspensions... OD 600 scores were measured through a 120-h period, and CFU/ml numbers were evaluated at the beginning of the experiment (t0), and after 24, 52, and 77 h of incubation" . This would reveal growth defects under different stress conditions.

  • Proteome analysis: Comparing protein profiles of wild-type and htpX mutant strains under stress conditions to identify accumulated substrates and affected pathways.

  • Intracellular survival assays: Given that B. ovis is classified as a classical intracellular species , comparing survival of wild-type and htpX mutant strains within macrophages or other relevant host cells.

  • Competition assays: Co-infecting host cells or animals with wild-type and htpX mutant strains to determine competitive fitness under physiological stress conditions.

How can protein-protein interaction studies identify potential substrates and interacting partners of HtpX in Brucella ovis?

Several methodologies can be employed to identify potential substrates and interacting partners of HtpX in B. ovis:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of HtpX to pull down protein complexes, followed by mass spectrometry identification of interacting partners.

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these could identify direct protein-protein interactions with HtpX.

  • Substrate trapping: Creating catalytically inactive HtpX variants that bind but do not cleave substrates, thus "trapping" them in stable complexes that can be isolated and identified.

  • Comparative proteomics: Similar to approaches used in genomic analysis , comparing the proteomes of wild-type and htpX mutant strains to identify accumulated proteins that might be HtpX substrates.

  • Chemical crosslinking coupled with mass spectrometry: This approach can capture transient interactions between HtpX and its substrates or regulatory partners.

  • Proximity labeling: Using methods like BioID or APEX2 fused to HtpX to biotinylate nearby proteins, which can then be isolated and identified.

  • In vitro validation: Following identification of potential substrates, in vitro cleavage assays with purified recombinant HtpX can confirm direct proteolytic relationships.

How can recombinant HtpX be incorporated into diagnostic assays for Brucella ovis infection?

Recombinant HtpX could be incorporated into diagnostic assays for B. ovis infection using approaches similar to those successfully employed with other recombinant proteins:

  • Serological assay development: Following the successful example of OMP25o and OMP31m in indirect ELISA, HtpX could be evaluated as a diagnostic antigen. The search results demonstrate that "recombinant protein has excellent immunogenicity and can accurately identify serum through indirect ELISA" . Optimization would involve determining "the optimal coating conditions... by checkerboard experiment" .

  • Differential diagnosis potential: If HtpX contains species-specific epitopes, it might help distinguish B. ovis infection from other Brucella species, similar to how "OMP25o and OMP31m were selected as candidate antigens to distinguish B. ovis induced antibody from B. melitensis induced antibody" .

  • Antigen preparation: Based on the methods described for other recombinant proteins, purified HtpX would need proper refolding to maintain antigenic epitopes. The research notes that "After purification and renaturation of our target proteins, we first tested their ability to detect serum antibodies" .

  • Validation against gold standards: Any new HtpX-based assay would require validation against established methods like RBPT (Rose Bengal plate agglutination test), as was done for other recombinant protein assays: "these two proteins were equal in detection of vaccinated serum antibodies and the results were consistent with traditional RBPT method" .

  • Combined diagnostic strategy: As suggested for other recombinant proteins, an HtpX-based serological test could be combined with PCR detection: "Our indirect ELISA based on two antigens is an effective serum screening strategy that can overcome the drawback of false negative in PCR. If this strategy can combine with PCR detection, the diagnosis of brucellosis will be more accurate" .

What is the potential for HtpX as a target for novel antimicrobials against Brucella ovis?

HtpX could serve as a promising target for novel antimicrobials against B. ovis for several reasons:

  • Essential function possibility: Similar to how some combinations of membrane protein mutations proved lethal to B. ovis , HtpX might be essential under certain conditions, particularly stress conditions relevant to infection.

  • Unique structural features: As a membrane-bound zinc metalloprotease, HtpX likely possesses unique structural features that could be targeted by specific inhibitors. Utilizing structural analysis approaches similar to those used for OMP25 and OMP31 would help identify druggable sites.

  • Conservation analysis: Using comparative genomic approaches as described in the search results would reveal whether HtpX is conserved across Brucella species, potentially allowing for broad-spectrum anti-Brucella agents.

  • Inhibitor screening approaches:

    • High-throughput screening of compound libraries against purified recombinant HtpX

    • Structure-based virtual screening based on HtpX structural models

    • Repurposing of known metalloprotease inhibitors

  • Resistance potential assessment: The antibiotic resistance gene identification methods mentioned in the search results could be applied to assess the likelihood of resistance development against HtpX inhibitors.

How might HtpX contribute to vaccine development strategies against Brucella ovis infections?

HtpX could contribute to vaccine development strategies against B. ovis infections in several ways:

  • Attenuated vaccine strains: HtpX mutants could be evaluated as potential live attenuated vaccine candidates. Similar to other B. ovis mutants described in the search results that showed "important in vitro and in vivo defects" , htpX mutants might maintain immunogenicity while exhibiting reduced virulence.

  • Subunit vaccine component: Recombinant HtpX could be included in subunit vaccines, potentially combined with other immunogenic proteins. The search results describe the successful expression and purification of recombinant B. ovis proteins , providing a methodological framework.

  • Immunological evaluation: Using approaches similar to those employed for other Brucella proteins, the immunogenicity of HtpX could be assessed: "reactivity of OMP25 and OMP31 with Brucella serum samples by ELISA" .

  • Differential vaccination strategies: If HtpX contains epitopes specific to B. ovis, it might allow for vaccines that protect against B. ovis while still allowing serological distinction from other Brucella species. This addresses the challenge mentioned in the search results: "it is difficult to distinguish between natural infection antibody positive and vaccination antibody positive" .

  • Combined approaches: HtpX could be part of multi-component vaccines targeting several virulence factors, similar to the approach of studying multiple gene mutations in B. ovis .

Table 1: Comparison of Key Brucella ovis Proteins for Research and Diagnostic Applications

ProteinMolecular WeightStructureFunctionDiagnostic PotentialResearch Applications
HtpXNot specified in search resultsPredicted membrane zinc metalloproteaseProtein quality control, stress responsePotential serological targetVirulence studies, antimicrobial target
OMP2523 kDaβ-barrel structure similar to OMP31 Inhibits macrophage TNF-α production, virulence factor High (OMP25o lacks 12 amino acids at C-terminus causing antigenic shift) Differential diagnosis of B. ovis infection
OMP3131 kDaβ-barrel structure with eight β-strands, 240 amino acid residues Pore-forming protein, peptidoglycan linkage High (OMP31m effective in serum screening) Protection studies, virulence research
OMP10Not specifiedLipoproteinRequired for viability when OMP19 is absent Not specifiedMutational analysis reveals essential functions
OMP19Not specifiedLipoproteinRequired for viability when OMP10 is absent Not specifiedMutational analysis reveals essential functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.