Recombinant Brucella ovis UPF0283 membrane protein BOV_0999 (BOV_0999)

Shipped with Ice Packs
In Stock

Description

What is Recombinant Brucella ovis UPF0283 Membrane Protein BOV_0999 (BOV_0999)?

Recombinant Brucella ovis UPF0283 membrane protein BOV_0999 (BOV_0999) is a protein associated with the bacterium Brucella ovis, which is a significant pathogen in sheep, causing ovine brucellosis . The protein is also called UPF0283 membrane protein BOV_0999 .

Research Findings

While there is no specific research available on the Recombinant Brucella ovis UPF0283 membrane protein BOV_0999 (BOV_0999), research exists regarding other outer membrane proteins (OMPs) of Brucella ovis that have been explored for their potential in diagnostics and vaccine development .

  • Outer Membrane Proteins (OMPs) OMPs are major components of the Brucella ovis cell surface and play a crucial role in the bacterium's interaction with the host immune system .

  • Diagnostic Potential Some OMPs have shown potential as diagnostic markers for Brucella ovis infection . For example, OMP25o displays differences from OMP25m, making it useful in identifying B. ovis infections .

  • Vaccine Development Recombinant OMPs have been investigated as vaccine candidates against Brucella infections. Vaccination with recombinant OMP31 in mice has shown to provide protection against B. ovis and B. melitensis infections .

Tables and Figures

ProteinDescription
OMP25Highly conserved among Brucella species; involved in inhibiting macrophage TNF-α production .
OMP31Pore-forming protein; immunity based on B. melitensis can give protection against B. ovis infection .
OMP25oLacks 12 amino acid residues on the C terminal, corresponding to the fourth loop of the seventh and eighth strands. This could cause an antigenic shift in both linear and non-linear epitopes, which could be used in the identification of B. ovis infection .
Hot saline extractsComposed of vesicles with outer membrane proteins (OMPs), lipopolysaccharide, and phospholipid as constituents .

Figure 3: Reactivity of OMP25 and OMP31 with Brucella serum samples by ELISA .

(A) The recombinant OMP25 protein was used as the antigen (5μg/mL) to coat the plate, and the serum was diluted at a ratio of 1:10; 100 positive serums and 32 negative serums, of which 20 negative serums were used to calculate the cut off. The test results are shown in the figure: orange represents the test result of negative serum, blue represents the result of positive serum, and the gray line is the cut off value.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of specific tags if you provide your requirements in advance.
Synonyms
BOV_0999; UPF0283 membrane protein BOV_0999
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Target Names
BOV_0999
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFVRADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARMGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links

KEGG: bov:BOV_0999

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of Brucella ovis UPF0283 membrane protein BOV_0999?

BOV_0999 belongs to the UPF0283 family of uncharacterized membrane proteins found in Brucella species. While the specific function of this protein remains largely unknown, structural prediction analyses suggest it likely contains multiple transmembrane domains typical of bacterial membrane proteins. Computational analyses based on sequence homology with other bacterial membrane proteins indicate potential roles in cellular transport, signaling, or maintenance of membrane integrity. Structural prediction algorithms suggest BOV_0999 may adopt a topology similar to other bacterial membrane proteins with multiple alpha-helical transmembrane segments spanning the bacterial membrane. The protein likely contains both periplasmic and cytoplasmic domains that could participate in protein-protein interactions or substrate binding. Understanding the structure-function relationship of BOV_0999 requires both computational prediction and experimental validation approaches, including crystallography or cryo-electron microscopy .

What purification strategies are effective for isolating BOV_0999 while maintaining its native conformation?

Purification of membrane proteins like BOV_0999 requires carefully optimized protocols to maintain protein stability and native conformation. The initial step typically involves membrane isolation followed by solubilization using appropriate detergents. For BOV_0999, mild non-ionic detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are recommended starting points for solubilization trials. Affinity chromatography using histidine tags is commonly employed as the first purification step, with imidazole gradient elution to separate full-length protein from truncated products . Size exclusion chromatography serves as a crucial polishing step to ensure monodispersity and remove protein aggregates. Throughout the purification process, protein stability should be monitored using techniques such as dynamic light scattering or thermal shift assays. For structural studies, detergent exchange or reconstitution into lipid nanodiscs may be necessary to mimic the native membrane environment. Careful optimization of buffer conditions including pH, salt concentration, and glycerol content is essential for maintaining protein stability during and after purification .

How can BOV_0999 be structurally characterized, and what challenges are associated with membrane protein crystallization?

Structural characterization of BOV_0999 presents significant challenges typical of membrane proteins. X-ray crystallography remains a powerful approach, though crystallizing membrane proteins requires specialized techniques. Lipidic cubic phase (LCP) crystallization has proven successful for many membrane proteins and could be applied to BOV_0999. Alternatively, cryo-electron microscopy (cryo-EM) offers advantages for membrane proteins that resist crystallization, particularly when incorporated into nanodiscs or amphipols. Nuclear magnetic resonance (NMR) spectroscopy provides complementary information about protein dynamics, though size limitations may restrict its application to specific domains of BOV_0999. Common challenges include maintaining protein stability during purification, identifying optimal detergent conditions, and obtaining well-diffracting crystals. Researchers might consider high-throughput crystallization screening approaches similar to those employed by the Seattle Structural Genomics Center for Infectious Disease (SSGCID) for other Brucella proteins . Strategic approaches might include creating fusion constructs, truncated versions, or stability-enhancing mutations to improve crystallization properties while maintaining biological relevance.

What experimental approaches can determine the topology and membrane insertion mechanism of BOV_0999?

Understanding the topology and membrane insertion of BOV_0999 requires multiple complementary techniques. Cysteine scanning mutagenesis combined with accessibility assays can map transmembrane segments by determining which residues are accessible to membrane-impermeable reagents. Fluorescence protease protection assays can identify cytoplasmic versus periplasmic domains by assessing protein fragment protection from proteolytic digestion. In vivo experiments using reporter fusion constructs (such as PhoA or GFP) at various positions can indicate the cellular localization of different protein regions. Biochemical approaches including glycosylation mapping and biotinylation can further validate topological models. Advanced biophysical methods such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) provide detailed information about solvent-accessible regions and membrane-protected segments. For insertion mechanisms, in vitro translation systems combined with reconstituted membranes can reveal whether BOV_0999 utilizes co-translational or post-translational insertion pathways. Crosslinking experiments may identify translocon components that facilitate membrane insertion of this specific protein .

How does BOV_0999 contribute to B. ovis virulence and host-pathogen interactions?

The potential role of BOV_0999 in B. ovis virulence requires systematic investigation through multiple experimental approaches. Gene knockout or depletion studies using CRISPR-Cas9 or transposon mutagenesis can establish whether BOV_0999 is essential for bacterial viability or virulence. Infection models using both cell culture and animal systems (such as the pregnant mouse model described for other B. ovis proteins) can compare wild-type and BOV_0999-deficient strains for differences in colonization, persistence, and pathology development . Transcriptomic and proteomic analyses under infection-relevant conditions can reveal whether BOV_0999 expression changes during host interaction. Protein interaction studies using techniques such as co-immunoprecipitation or proximity labeling can identify host or bacterial proteins that interact with BOV_0999 during infection. If BOV_0999 functions as a transporter or channel, substrate identification using metabolomic approaches or transport assays would provide functional insights. Structural comparison with virulence factors from other pathogens may reveal functional similarities even in the absence of sequence homology. Understanding the contribution of BOV_0999 to pathogenesis could potentially identify new targets for vaccine development, similar to the protective immunity studies conducted with B. ovis ΔabcBA .

What are the optimal conditions for expressing soluble domains of BOV_0999 for antibody production and functional studies?

For antibody production and functional studies, expressing soluble domains of BOV_0999 rather than the full-length membrane protein often yields better results. Bioinformatic analysis should first identify hydrophilic regions likely to be exposed at the protein surface, typically corresponding to periplasmic or cytoplasmic domains. These domains can be expressed as fusion proteins with solubility-enhancing tags such as maltose-binding protein (MBP), glutathione S-transferase (GST), or SUMO. Expression optimization requires systematic testing of multiple variables including E. coli strain selection (BL21, Rosetta for rare codons, or SHuffle for disulfide bond formation), induction temperature (typically lowered to 16-20°C for improved folding), and inducer concentration (IPTG concentration gradient from 0.1-1.0 mM). Small-scale expression trials followed by solubility analysis via SDS-PAGE of supernatant versus pellet fractions will guide optimization. For purification, affinity chromatography followed by tag cleavage and polishing steps yields high-purity protein. The purified domains should undergo quality control via circular dichroism to confirm proper folding before immunization or functional assays. If soluble expression remains challenging, periplasmic expression systems or insect cell expression may provide alternatives .

How can protein-protein interactions involving BOV_0999 be identified and validated in the context of B. ovis infection?

Identifying protein-protein interactions involving membrane proteins like BOV_0999 requires specialized approaches that preserve the membrane environment. For initial screening, bacterial two-hybrid systems adapted for membrane proteins can identify potential interactors while maintaining the membrane context. Split-ubiquitin yeast two-hybrid systems offer an alternative specifically designed for membrane protein interactions. More direct approaches include co-immunoprecipitation using antibodies against BOV_0999 or an epitope tag, followed by mass spectrometry to identify binding partners. Proximity-dependent biotin identification (BioID) or APEX2 systems can capture transient or weak interactions by biotinylating proteins in the vicinity of BOV_0999. Validation of identified interactions should employ multiple orthogonal methods including fluorescence resonance energy transfer (FRET), biolayer interferometry, or surface plasmon resonance for quantitative binding parameters. For functional relevance, interaction studies should be performed under conditions mimicking the infection environment, such as acidic pH or nutrient limitation. Genetic approaches including simultaneous deletion of interaction partners can reveal functional relationships through synthetic phenotypes. The biological significance of verified interactions should be assessed in infection models to determine their relevance to B. ovis pathogenesis .

How can researchers differentiate between direct and indirect effects when studying BOV_0999 knockout phenotypes?

Differentiating between direct and indirect effects of BOV_0999 knockout requires comprehensive experimental design and careful controls. Complementation studies represent the gold standard approach, where reintroduction of the wild-type gene should restore the original phenotype if effects are direct. Conditional knockdown systems using inducible promoters or degradation tags provide temporal control, allowing observation of immediate versus delayed effects following protein depletion. Point mutations targeting specific functional domains can create separation-of-function alleles that disrupt particular activities while preserving others. Transcriptomic and proteomic analyses comparing wild-type, knockout, and complemented strains can identify regulatory networks affected by BOV_0999 absence. Metabolomic profiling can determine whether observed phenotypes result from specific metabolic perturbations rather than direct protein functions. Time-course experiments are particularly valuable for distinguishing primary effects (occurring rapidly after protein loss) from secondary adaptive responses. For in vivo studies, tissue-specific or cell-type-specific analyses can identify the primary sites of BOV_0999 activity during infection. Mathematical modeling of observed phenotypes incorporating known biological pathways can help predict direct versus cascade effects. When reporting results, researchers should clearly acknowledge limitations in distinguishing causality and consider alternative explanations for observed phenotypes .

What strategies can overcome expression and solubility issues specific to BOV_0999?

Expression and solubility challenges for BOV_0999 require systematic troubleshooting approaches tailored to membrane proteins. Codon optimization for the expression host can significantly improve translation efficiency, particularly for rare codons that might cause ribosomal stalling and premature termination. Fusion partners specifically designed for membrane proteins, such as Mistic, SUMO, or Fh8, can enhance membrane insertion and proper folding. Expression as truncated constructs focusing on specific domains may overcome toxicity issues associated with the full-length protein. For expression systems, C41(DE3) and C43(DE3) E. coli strains were specifically developed for toxic membrane proteins and might prove superior to standard BL21 strains. Membrane protein-specific vectors with tunable promoter strength allow optimization of expression levels to balance protein production with potential toxicity. If inclusion bodies form despite optimization, specialized refolding protocols using mild detergents and gradient dialysis can sometimes recover properly folded protein. The addition of chemical chaperones such as glycerol, specific lipids, or stabilizing ligands to growth media may improve folding efficiency. For particularly challenging cases, cell-free expression systems allow direct synthesis into artificial liposomes or nanodiscs, bypassing cellular toxicity issues. Systematic screening of these approaches should be documented in a structured manner to identify successful conditions that can be scaled up for larger production .

How can researchers develop reliable functional assays for an uncharacterized membrane protein like BOV_0999?

Developing functional assays for uncharacterized proteins like BOV_0999 requires a multi-faceted approach beginning with bioinformatic predictions. Sequence analysis using tools like HMMER or BLAST against characterized proteins might reveal distant homology providing functional clues. Genomic context analysis examining neighboring genes can suggest involvement in specific pathways, as operons often contain functionally related genes. For potential transport functions, liposome reconstitution assays with fluorescent substrates can detect transport activity across a range of candidate molecules. Bacterial growth assays comparing wild-type and knockout strains under various stress conditions (oxidative, osmotic, pH, nutrient limitation) may reveal conditions where BOV_0999 function becomes essential. For potential enzymatic activity, substrate screening panels combined with appropriate detection methods (colorimetric, fluorescent, or coupled enzyme assays) can identify catalytic functions. Thermal shift assays can identify ligands that stabilize the protein, suggesting binding partners. Electrophysiology techniques like patch-clamp or planar lipid bilayer recordings can characterize channel or transporter properties if suspected. Reporter systems fused to promoters responding to cellular stresses can identify conditions affecting BOV_0999 function. The development process should begin with broader, less specific assays before refining to more targeted approaches as functional hypotheses emerge .

How does BOV_0999 compare structurally and functionally to homologous proteins in other Brucella species and related bacteria?

Comparative analysis of BOV_0999 with homologs in other species provides evolutionary context and functional insights. Sequence alignment analysis across Brucella species typically reveals high conservation of membrane proteins involved in essential functions, with variable regions potentially indicating host-adaptation. Structural homology modeling using related proteins with solved structures, such as those from the Seattle Structural Genomics Center for Infectious Disease collection of over 120 Brucella protein structures, can predict conserved structural elements even when sequence identity is low . Phylogenetic analysis can trace the evolutionary history of BOV_0999, identifying potential horizontal gene transfer events or adaptive evolution under selective pressure. Comparison with more distant homologs in alpha-proteobacteria may reveal ancestral functions that preceded specialization in host-pathogen interactions. Genomic synteny analysis examining gene neighborhood conservation across species can indicate functional relationships maintained throughout evolution. Experimental comparison of BOV_0999 with homologs from other Brucella species through complementation studies in knockout strains can determine functional interchangeability. Host range differences between Brucella species (B. ovis primarily infecting sheep versus B. abortus infecting cattle) may correlate with sequence variations in membrane proteins like BOV_0999, potentially indicating host adaptation mechanisms. Comparison of protein interaction networks across species can reveal conserved versus species-specific interaction partners .

What evolutionary signatures in the BOV_0999 sequence suggest functional constraints or adaptive evolution?

Evolutionary analysis of BOV_0999 can reveal functional constraints and adaptive processes shaping its sequence. Calculation of nonsynonymous to synonymous substitution ratios (dN/dS) across different regions of the protein can identify domains under purifying selection (low dN/dS indicating functional constraint) versus positive selection (high dN/dS suggesting adaptive evolution). Conserved motifs identified through multiple sequence alignment often correspond to functionally critical regions such as substrate binding sites or protein-protein interaction interfaces. Analysis of coevolutionary patterns using methods like direct coupling analysis can identify residue pairs that maintain contact in the three-dimensional structure, providing insights into structural constraints. Comparison of BOV_0999 sequences across isolates from different geographical regions may reveal environment-specific adaptations. Identification of horizontal gene transfer signatures through unusual GC content, codon usage bias, or phylogenetic incongruence can indicate acquisition of novel functions during evolution. Analysis of sequence variation in clinical versus laboratory-adapted strains may highlight adaptations to different selective pressures. Conservation analysis specifically focusing on predicted transmembrane regions versus loop regions can determine whether membrane topology is more constrained than exposed domains. These evolutionary signatures should be interpreted in the context of Brucella pathogenesis and host adaptation to generate testable hypotheses about BOV_0999 function .

What emerging technologies could accelerate characterization of BOV_0999 and similar membrane proteins?

Emerging technologies are revolutionizing membrane protein research and could significantly advance BOV_0999 characterization. Cryo-electron microscopy advancements now allow near-atomic resolution of membrane proteins without crystallization, particularly valuable for conformationally heterogeneous proteins. Advances in mass spectrometry techniques including native mass spectrometry and hydrogen-deuterium exchange mass spectrometry provide detailed insights into membrane protein topology, dynamics, and interactions. Single-molecule approaches such as force spectroscopy or fluorescence resonance energy transfer can capture rare conformational states and kinetic parameters of transporters or channels. Artificial intelligence applications including AlphaFold2 have dramatically improved protein structure prediction accuracy, potentially providing reliable structural models even without experimental structures . Nanobody technology offers tools for both structural stabilization during crystallization and functional modulation for mechanistic studies. High-throughput functional genomics using CRISPR interference or activation can systematically identify genetic interactions revealing functional networks. Microfluidic systems enable rapid screening of crystallization conditions or functional assays with minimal protein consumption. Cell-free expression systems specifically optimized for membrane proteins provide rapid production without cellular toxicity limitations. Advanced imaging techniques such as super-resolution microscopy can visualize membrane protein localization and dynamics in bacterial cells with unprecedented detail. Integration of these technologies within a systematic research program would accelerate comprehensive characterization of BOV_0999 .

How might structural information about BOV_0999 inform development of novel therapeutics against Brucella ovis infections?

Structural information about BOV_0999 could significantly impact therapeutic development through multiple pathways. Structure-based drug design targeting specific binding pockets or functional domains identified in BOV_0999 could yield selective inhibitors disrupting essential functions. Comparison with homologous proteins in other pathogenic bacteria might reveal conserved sites suitable for broad-spectrum antibiotic development. If BOV_0999 participates in host-pathogen interactions, structural characterization of these interfaces could guide development of interaction blockers. Identification of conformational changes associated with BOV_0999 function might allow design of conformation-specific inhibitors that lock the protein in inactive states. Fragment-based drug discovery approaches starting with weak-binding chemical fragments identified through crystallographic or NMR screening could be optimized into high-affinity ligands. Virtual screening against BOV_0999 structural models could rapidly identify potential inhibitors from chemical libraries for experimental validation. Epitope mapping using structural data could guide development of antibodies or vaccines targeting accessible regions of BOV_0999. Peptide mimetics designed to compete with natural binding partners could disrupt essential protein-protein interactions. Drug repurposing approaches may identify existing approved compounds that bind to structural features present in BOV_0999. For all therapeutic applications, comparative analysis with homologous human proteins is essential to ensure selectivity and minimize off-target effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.