Recombinant Brucella suis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Properties

Recombinant Brucella suis ATP synthase subunit a (atpB) is a 249-amino acid protein (UniProt ID: B0CK70) fused to an N-terminal His tag, expressed in Escherichia coli . It forms part of the F1_1FO_O-ATP synthase complex, which catalyzes ATP synthesis via proton gradient-driven rotation. Key properties include:

PropertyDetail
Molecular Weight~28 kDa (theoretical)
TagN-terminal His tag
Expression HostE. coli
FunctionProton channel formation in FO_O sector; couples proton flow to ATP synthesis

Role in ATP Synthase Complex

  • The F1_1FO_O-ATP synthase comprises α3_3β3_3γδε subunits (F1_1) and ab2_2c1015_{10-15} subunits (FO_O) . Subunit a (atpB) anchors the FO_O sector to the membrane and facilitates proton translocation.

  • In Mycobacterium smegmatis, the αCTD (C-terminal domain of subunit α) regulates ATP hydrolysis inhibition, a mechanism likely conserved in Brucella .

Acid Stress Response

  • Under acidic conditions (pH 4.5), Brucella upregulates ATP synthase genes (atpB, atpG, atpD), suggesting a role in pH homeostasis by extruding protons via ATP hydrolysis .

  • This activity supports intracellular survival in macrophages, where acidic phagosomes are a key host defense .

Drug Target Validation

  • The F1_1FO_O-ATP synthase is a validated target for tuberculosis and nontuberculous mycobacteria . Inhibitors targeting the γ-loop (e.g., GaMF1) disrupt ATP synthesis, a strategy potentially applicable to Brucella .

  • Recombinant atpB enables high-throughput screening for species-specific inhibitors.

Diagnostic and Immunogenic Potential

  • While not directly used in current diagnostics, ATP synthase subunits are immunogenic. Proteomic studies identify Brucella outer membrane vesicles (OMVs) containing ATP synthase components, suggesting vaccine candidacy .

Comparative Analysis with Other Pathogens

FeatureBrucella suis atpBMycobacterium smegmatis atpB
Regulatory DomainsLacks αCTD (present in α subunit) αCTD mediates ATP hydrolysis inhibition
Acid Stress ResponseUpregulated at pH 4.5 Not explicitly reported
Na+^+ DependenceUncharacterizedNa+^+-dependent in Eubacterium

Technical Challenges and Innovations

  • Expression and Purification: The His-tagged recombinant protein simplifies purification via nickel-affinity chromatography .

  • Functional Reconstitution: ATP synthase complexes require liposome reconstitution for activity assays, a method validated in Eubacterium callanderi .

Pathogenic Significance

  • Intracellular Survival: ATP synthase activity sustains energy production in phagosomes, enabling chronic infection .

  • Immune Evasion: Brucella suppresses host apoptosis via JAK2/STAT3 signaling, indirectly relying on ATP-dependent processes .

Future Directions

  • Structural Studies: Cryo-EM of B. suis F1_1FO_O-ATP synthase could reveal drug-binding pockets.

  • Metabolic Modeling: Integrate transcriptomic data to map ATP synthase regulation under stress.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping is available upon request; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; BSUIS_A0410; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
atpB
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a critical role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Brucella suis ATP synthase subunit a (atpB)?

Recombinant Brucella suis ATP synthase subunit a (atpB) is a full-length protein (249 amino acids) that forms a critical component of the F1F0-ATPase/ATP-synthase complex in Brucella suis. For research purposes, it is typically expressed in E. coli with an N-terminal His tag to facilitate purification and analysis. This protein (UniProt ID: B0CK70) is also known by synonyms including "ATP synthase F0 sector subunit a" and "F-ATPase subunit 6" . The recombinant form allows researchers to study the protein's structure, function, and potential role in bacterial pathogenesis outside the constraints of working with live Brucella, which requires specialized containment facilities.

What is the primary function of ATP synthase subunit a in Brucella suis?

ATP synthase subunit a in Brucella suis is a critical component of the F1F0-ATPase/ATP-synthase complex, which serves dual functions in bacterial physiology. Primarily, this membrane-embedded subunit forms part of the proton channel in the F0 sector that enables proton translocation across the bacterial membrane. The protein participates in:

  • ATP synthesis: Utilizing the proton gradient to generate ATP through oxidative phosphorylation

  • pH homeostasis: Under acidic conditions, the complex can function in reverse as an ATPase, consuming ATP to pump protons out of the cell

This dual functionality is particularly important for Brucella suis, which must adapt to the acidic environment within host cell phagosomes during infection. The ATPase activity contributes to acid resistance by helping maintain cytoplasmic pH through proton extrusion, which consumes ATP but is necessary for survival in acidic environments . This pH regulation capability is essential for Brucella's intracellular lifestyle and pathogenicity.

What are the optimal storage and reconstitution conditions for recombinant atpB protein?

For optimal preservation and experimental reproducibility when working with recombinant Brucella suis atpB protein, researchers should adhere to the following protocol:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Perform aliquoting immediately after reconstitution to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for storage stability

  • If using for experimental procedures, reconstitute in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Adhering to these conditions is crucial for maintaining protein stability and functionality for downstream applications such as structural studies, enzymatic assays, or protein-protein interaction experiments.

How can researchers validate the functional activity of recombinant atpB protein?

Validating the functional activity of recombinant Brucella suis atpB protein requires multiple complementary approaches:

1. ATP Hydrolysis Assay:

  • Measure ATPase activity using a coupled enzymatic assay that monitors phosphate release

  • Compare activity rates at different pH values (pH 4.5 vs. pH 7.0) to assess pH-dependent functionality

  • Include specific F1F0-ATPase inhibitors (e.g., DCCD or oligomycin) as controls

2. Proton Translocation Assay:

  • Reconstitute purified atpB protein along with other F0 components into liposomes

  • Monitor proton movement using pH-sensitive fluorescent dyes (e.g., ACMA)

  • Assess changes in fluorescence upon addition of ATP, indicating proton pumping activity

3. Protein-Protein Interaction Studies:

  • Perform co-immunoprecipitation with other ATP synthase components to verify complex formation

  • Use surface plasmon resonance (SPR) to quantify binding affinities with partner proteins

  • Employ crosslinking studies to identify interaction regions within the ATP synthase complex

4. Structural Validation:

  • Conduct circular dichroism (CD) spectroscopy to confirm proper secondary structure

  • Compare with published structural data on ATP synthase subunit a from related organisms

These methods provide comprehensive validation of both structural integrity and functional capacity of the recombinant protein, ensuring reliable results in downstream research applications.

How does atpB contribute to acid resistance in Brucella suis?

The atpB protein plays a crucial role in acid resistance mechanisms of Brucella suis through its function in the F1F0-ATPase/ATP-synthase complex. This contribution operates through several mechanisms:

Proton Extrusion Mechanism:
The F1F0-ATPase complex can function as an ATPase under acidic conditions, hydrolyzing ATP to pump protons out of the bacterial cytoplasm. This action directly contributes to maintaining internal pH homeostasis when Brucella encounters acidic environments, such as within the phagosome of host macrophages . The subunit a (atpB) forms part of the proton channel in the membrane-embedded F0 portion of the complex, making it essential for this activity.

Energy Production for Acid Resistance Systems:
Studies in related bacteria have shown that ATP production capacity is essential for acid resistance. In E. coli, increases in intracellular ATP concentration occur during rapid shifts from neutral pH to acidic conditions (pH 3.5) . This ATP may power various acid resistance mechanisms including:

  • ATP-dependent proteases that remove damaged proteins

  • Molecular chaperones that protect protein structure

  • ATP-dependent transporters involved in maintaining ion balance

This multifaceted contribution to acid resistance is particularly important for Brucella suis as an intracellular pathogen that must survive the acidified environment of the phagosome during infection.

What is the relationship between atpB and the Twin Arginine Translocation (Tat) system in Brucella?

The relationship between atpB and the Twin Arginine Translocation (Tat) system in Brucella suis represents an interesting intersection of bacterial bioenergetics and protein export machinery. While direct evidence for atpB being a Tat substrate in Brucella was not explicitly mentioned in the search results, several important connections can be established:

Potential Tat Dependency:
Research on the Brucella suis proteome identified 28 proteins with putative Tat signal sequences, of which 20 were confirmed to engage the Tat pathway . Many of these confirmed Tat substrates are involved in energy metabolism, electron transport, and redox reactions. Given that ATP synthase components often contain cofactors and function in electron transport chains, atpB may potentially interact with Tat-dependent pathways.

Essentiality of Both Systems:
The Tat system has been demonstrated to be essential for viability in Brucella suis, as researchers were unable to create viable Tat system mutants despite multiple different strategies . Similarly, the ATP synthase complex plays a critical role in energy metabolism and acid resistance. This parallel essentiality suggests potential functional interdependence.

Bioenergetic Connection:
The Tat system requires the proton motive force for its function, which is directly related to the activity of the F1F0-ATP synthase. When ATP synthase functions as an ATP synthase, it generates proton motive force, which could potentially power the Tat machinery. Conversely, when functioning as an ATPase to extrude protons, it could impact the energy available for Tat-dependent translocation.

Research Approach to Investigate Relationship:
Researchers wanting to explore this relationship could employ the heterologous reporter assay described in the literature, which uses the Tat-dependent amidase AmiA to confirm engagement with the Tat pathway . By creating an atpB signal sequence-AmiA fusion and testing its ability to restore SDS resistance in a ΔssamiAC strain (but not in a ΔtatC strain), researchers could determine if atpB directly interacts with the Tat system.

This relationship represents an important area for future research, as understanding the interconnections between essential systems could reveal new targets for antimicrobial development.

How can atpB be utilized as a target for developing antimicrobial strategies against Brucella?

The atpB subunit of ATP synthase presents a promising target for antimicrobial development against Brucella suis, particularly due to its essential role in bacterial bioenergetics and stress adaptation. Several strategic approaches could be employed:

Small Molecule Inhibitors:
Targeted inhibitors of the F0 sector proton channel, where atpB resides, could disrupt both ATP synthesis and proton extrusion capabilities. This dual targeting would compromise both energy generation and acid resistance mechanisms simultaneously. Researchers could screen compound libraries for molecules that:

  • Bind specifically to the proton channel region of atpB

  • Disrupt protein-protein interactions between atpB and other subunits

  • Alter conformational changes necessary for proton translocation

Peptide-Based Inhibitors:
Based on the known amino acid sequence of atpB , researchers could design peptide mimetics that interfere with essential protein-protein interactions within the ATP synthase complex. These peptides could be derived from:

  • Interface regions between atpB and other subunits

  • Conserved functional domains critical for proton translocation

  • Regions involved in assembly of the complete ATP synthase complex

Inhibition of Essential Systems:
Research has demonstrated that the Tat system is essential for Brucella suis viability, and inhibitors of the Pseudomonas aeruginosa Tat system have been shown to inhibit Brucella growth in vitro . Given the potential relationship between ATP synthase function and Tat-dependent processes, dual targeting of both systems might produce synergistic antimicrobial effects.

Evaluation Framework:
The efficacy of atpB-targeted antimicrobials could be assessed using a systematic approach:

Assessment LevelMethodsKey Parameters
BiochemicalATP hydrolysis assaysIC50 values
Proton translocation assaysInhibition kinetics
CellularGrowth inhibitionMIC determination
Intracellular survival in macrophagesBacterial load reduction
Acid resistanceSurvival at pH 4.5
StructuralX-ray crystallographyBinding site verification
Molecular dynamicsMechanism of action
In vivoMouse infection modelsBacterial clearance
Tissue distributionPharmacokinetics

This multifaceted approach recognizes atpB as a high-value antimicrobial target due to its essential role in bacterial bioenergetics and the challenge of treating intracellular pathogens like Brucella suis.

What methodologies can be used to study atpB interactions with the immune system during Brucella infection?

Investigating how atpB interacts with the host immune system during Brucella infection requires sophisticated methodologies spanning immunology, molecular biology, and cellular biology. The following approaches would yield valuable insights:

1. Infection Models with Immune Cell Co-culture:
Building upon the macrophage-lymphocyte co-culture system described in search result , researchers can develop more complex models to study atpB's role in immune interactions:

  • Establish human macrophage infection systems with B. suis strains expressing modified atpB variants

  • Introduce activated γ9δ2 T lymphocytes to assess bacterial survival and immune response

  • Compare wild-type bacteria with strains containing mutations in atpB to identify immune evasion mechanisms

2. Antigenic Epitope Mapping:

  • Synthesize overlapping peptides spanning the atpB sequence

  • Screen for immunoreactivity with serum from Brucella-infected hosts

  • Identify specific epitopes that trigger B and T cell responses

  • Assess cross-reactivity with ATP synthase components from other bacterial species

3. Proteomic Analysis of Host-Pathogen Interface:

  • Employ proximity labeling techniques (BioID, APEX) with tagged atpB to identify host proteins in close proximity during infection

  • Perform immunoprecipitation followed by mass spectrometry to isolate atpB-interacting host factors

  • Use SILAC or TMT labeling to quantify changes in the host proteome in response to atpB exposure

4. Immune Signaling Pathway Analysis:

  • Monitor activation of pattern recognition receptors (TLRs, NLRs) in response to purified atpB

  • Assess cytokine/chemokine profiles using multiplex assays following exposure to atpB

  • Examine phosphorylation cascades in key immune signaling pathways (NF-κB, MAPK, IRF)

5. Advanced Microscopy Techniques:

  • Utilize super-resolution microscopy to visualize atpB localization during different stages of infection

  • Employ live-cell imaging to track dynamics of immune cell interactions with Brucella-infected cells

  • Use FRET/BRET to detect molecular interactions between atpB and host immune components

These methodologies would help determine whether atpB plays a direct role in immune modulation or if its primary contribution to virulence is through supporting bacterial metabolism and stress resistance during infection. The system described in search result for screening genes involved in γ9δ2 T cell resistance provides an excellent foundation for these investigations.

How does the structure and function of Brucella suis atpB compare with homologous proteins in other bacterial pathogens?

Structural Comparison:
The 249-amino acid atpB protein from Brucella suis shares core structural features with ATP synthase subunit a from other bacteria, while exhibiting specific adaptations. Key structural elements include:

FeatureBrucella suisE. coliMycobacterium tuberculosisSignificance
Length249 aa 271 aa250 aaB. suis has a relatively compact structure
Transmembrane helices5-6 predicted5 confirmed5 predictedConserved core membrane topology
Arginine fingerPresent (conserved)PresentPresentEssential for proton translocation
C-terminal domainShorterExtendedVariableMay affect interactions with F1 sector

Functional Adaptations:
The atpB protein in Brucella suis shows functional specializations related to its intracellular lifestyle:

  • Acid Resistance Specialization: The B. suis ATP synthase complex shows specific adaptations for function under acidic conditions, with several components including subunits of the complex being upregulated at pH 4.5 . This contrasts with obligate extracellular pathogens that don't require such extensive acid adaptation.

  • Bioenergetic Flexibility: Similar to findings in E. coli, the B. suis ATP synthase likely functions bidirectionally (as ATP synthase and ATPase) to maintain pH homeostasis under diverse conditions . This flexibility is particularly important for intracellular pathogens that face varying nutrient and pH environments.

  • Integration with Essential Systems: The relationship between atpB and other essential systems like the Tat pathway may differ between bacterial species. In B. suis, the Tat system is essential for viability, unlike in many other bacteria , suggesting potential specialized interactions with bioenergetic systems.

Evolutionary Implications:
Phylogenetic analysis places B. suis atpB among the Alphaproteobacteria, showing closest homology with other intracellular pathogens and symbionts. This positioning reflects adaptations to similar ecological niches and evolutionary pressures. The conservation of atpB across bacterial species highlights its fundamental importance, while specific adaptations in B. suis likely contribute to its success as an intracellular pathogen.

This comparative analysis provides insights into how evolution has shaped this essential protein across different bacterial lineages and helps identify both universal targets for broad-spectrum antibiotics and specialized features that could be exploited for Brucella-specific therapeutic approaches.

What are common challenges in expressing and purifying recombinant Brucella suis atpB, and how can they be addressed?

Expressing and purifying membrane proteins like Brucella suis atpB presents several technical challenges due to their hydrophobic nature and complex folding requirements. Below are common challenges researchers encounter and recommended solutions:

Challenge 1: Low Expression Levels

  • Problem: Hydrophobic membrane proteins often express poorly in standard E. coli systems.

  • Solutions:

    • Optimize codon usage for E. coli expression

    • Use specialized E. coli strains (C41/C43, Rosetta) designed for membrane protein expression

    • Test different promoter systems (T7, tac, ara) for optimal expression

    • Reduce expression temperature to 18-20°C to slow protein production and allow proper folding

    • Consider alternative expression hosts such as Lactococcus lactis or cell-free expression systems

Challenge 2: Protein Misfolding and Aggregation

  • Problem: atpB may form inclusion bodies or aggregate during expression.

  • Solutions:

    • Express as fusion with solubility-enhancing partners (MBP, SUMO, thioredoxin)

    • Include molecular chaperones (GroEL/ES, DnaK) by co-expression

    • Add stabilizing agents like glycerol (5-10%) to growth media

    • For recovery from inclusion bodies, use specialized refolding protocols with gradual detergent dialysis

Challenge 3: Difficulties in Solubilization and Purification

  • Problem: Extracting and maintaining stability of membrane proteins during purification.

  • Solutions:

    • Screen multiple detergents for optimal solubilization (DDM, LDAO, Triton X-100)

    • Include lipids during purification to maintain native-like environment

    • Use styrene maleic acid lipid particles (SMALPs) to extract protein with surrounding lipids

    • Implement on-column detergent exchange during affinity purification

    • Include stabilizing agents (glycerol, specific lipids) in all buffers

Optimization Table for IMAC Purification:

ParameterStarting ConditionOptimization OptionsNotes
DetergentDDM (0.05%)LDAO, Triton X-100, DigitoninScreen detergents systematically
BufferTris-HCl pH 8.0HEPES, PhosphateTest pH range 7.0-8.5
SaltNaCl 300 mM150-500 mMHigher salt may reduce non-specific binding
Imidazole20 mM (wash)10-40 mMOptimize to reduce non-specific binding
250 mM (elution)200-500 mMEnsure complete elution
AdditivesNone10% Glycerol, 5 mM ATPStabilize native conformation

Challenge 4: Verifying Proper Folding and Functionality

  • Problem: Ensuring recombinant protein maintains native structure and activity.

  • Solutions:

    • Perform circular dichroism (CD) spectroscopy to confirm secondary structure

    • Validate by reconstituting purified protein into liposomes for functional assays

    • Use thermal shift assays to assess protein stability under different buffer conditions

    • Employ limited proteolysis to verify compact, folded structure

These methodological approaches address the specific challenges of working with membrane proteins like atpB while maintaining protein stability and functionality for downstream applications.

What controls and validation steps should be included when studying atpB-dependent phenotypes in Brucella?

When investigating atpB-dependent phenotypes in Brucella, rigorous controls and validation steps are essential to ensure experimental reliability and accurate interpretation of results. The following comprehensive framework should be implemented:

Genetic Validation Controls:

  • Complementation Studies:

    • Generate complemented strains where atpB is expressed in trans from a plasmid

    • Include both wild-type atpB and site-directed mutants affecting key functional residues

    • Ensure complementation restores phenotypes to wild-type levels

  • Conditional Expression Systems:

    • Since complete deletion of atpB may be lethal (similar to the essential nature of the Tat system in Brucella ), employ inducible promoters

    • Use the anhydrotetracycline (ATC)-inducible tetracycline resistance promoter system as described for Tat studies

    • Validate expression levels using qRT-PCR and Western blot under different inducer concentrations

  • Domain-Specific Mutations:

    • Create targeted mutations in functional domains rather than full deletions

    • Focus on residues in the proton channel or at subunit interfaces

    • Confirm mutations don't cause global protein misfolding using structural assays

Phenotypic Validation Parameters:

Phenotype CategoryAssay MethodsEssential ControlsExpected Results
Growth Characteristics- Growth curves in rich/minimal media
- Colony size measurement
- Competitive index in mixed cultures
- Wild-type strain
- Unrelated gene mutant
- Growth at different temperatures
atpB modification may show growth defects particularly in nutrient-limited conditions
Acid Resistance- Survival after acid shock (pH 4.5)
- Internal pH measurement using fluorescent probes
- Expression of acid resistance genes
- Test multiple time points
- Include pH 7.0 baseline
- Include known acid-sensitive mutant
Defects in atpB should reduce acid tolerance compared to wild-type
Stress Response- Oxidative stress (H₂O₂, paraquat)
- Nutrient limitation
- Temperature stress
- Include control stressors
- Measure viability not just growth
- Include known stress-sensitive strain
ATP synthase mutants often show pleiotropic stress sensitivity
Intracellular Survival- Macrophage infection assays
- Co-culture with immune cells
- In vivo infection models
- Professional vs. non-professional phagocytes
- Activated vs. non-activated macrophages
- γ9δ2 T cell co-culture
Defective intracellular replication, especially in activated immune environment

Biochemical Validation:

  • ATP Levels and Energetics:

    • Measure intracellular ATP concentration under different conditions

    • Assess membrane potential using fluorescent probes

    • Monitor oxygen consumption rates as indicator of respiratory activity

  • Protein Expression and Interaction:

    • Quantify expression of other ATP synthase components to detect compensatory changes

    • Perform co-immunoprecipitation to verify complex assembly

    • Use blue native PAGE to assess integrity of the complete ATP synthase complex

  • Functional Assays:

    • Measure ATP synthesis/hydrolysis rates in membrane vesicles

    • Assess proton pumping activity using pH-sensitive fluorescent dyes

    • Evaluate pH homeostasis under acid stress conditions

By implementing this comprehensive validation framework, researchers can confidently attribute observed phenotypes to atpB function while controlling for potential indirect effects, compensatory mechanisms, or experimental artifacts.

What emerging technologies could advance our understanding of atpB's role in Brucella suis pathogenesis?

Several cutting-edge technologies are poised to significantly advance our understanding of atpB's role in Brucella suis pathogenesis. These emerging approaches could overcome current limitations and provide unprecedented insights into this protein's function:

1. CRISPR Interference (CRISPRi) for Conditional Knockdown:
The essential nature of ATP synthase components makes traditional knockout approaches challenging. CRISPR interference allows tunable, reversible repression of gene expression, enabling researchers to:

  • Create partial atpB knockdown rather than lethal complete knockout

  • Study dose-dependent effects by modulating degree of repression

  • Implement time-resolved repression to study atpB requirements at different infection stages

  • This approach circumvents the difficulties encountered in generating traditional gene knockouts as observed with the Tat system

2. Cryo-Electron Microscopy for Structural Analysis:
Recent advances in cryo-EM resolution now enable membrane protein visualization at near-atomic resolution without crystallization:

  • Determine the complete structure of Brucella ATP synthase complex in different conformational states

  • Visualize the arrangement of atpB within the proton channel

  • Compare structures under different pH conditions to understand acid adaptation mechanisms

  • Map interaction interfaces with other bacterial or host proteins

3. Advanced Imaging Technologies:
Novel imaging approaches can provide spatial and temporal insights into atpB function:

  • Super-resolution microscopy to visualize ATP synthase distribution during different infection stages

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Live-cell imaging with pH-sensitive fluorescent proteins to monitor local pH changes at ATP synthase locations

  • Expansion microscopy to achieve nanoscale resolution of protein complexes in situ

4. Single-Cell Transcriptomics and Proteomics:
Heterogeneity in bacterial populations during infection can be captured with single-cell approaches:

  • Single-cell RNA sequencing to identify subpopulations with differential atpB expression

  • Mass cytometry (CyTOF) with metal-labeled antibodies against atpB and other bacterial proteins

  • Spatial transcriptomics to map expression patterns within infected tissues

  • These approaches could reveal previously undetected specialized subpopulations during infection

5. Microfluidic Devices for Dynamic Studies:
Microfluidic systems enable precise control of the microenvironment and real-time monitoring:

  • Create pH, nutrient, or oxygen gradients to study atpB regulation under varying conditions

  • Implement rapid environmental shifts to study dynamic responses

  • Integrate with imaging to capture single-cell responses to changing conditions

  • These systems could model the dynamic conditions encountered during different stages of infection

6. Synthetic Biology Approaches:
Engineering approaches can provide functional insights through controlled modification:

  • Design minimal ATP synthase complexes with defined components to determine essential interactions

  • Create chimeric ATP synthase with subunits from different species to identify adaptation-specific regions

  • Develop optogenetic control of ATP synthase activity for temporal studies of energetic requirements

  • Engineer reporter systems directly coupled to ATP synthase activity for real-time monitoring

These innovative technologies, particularly when used in combination, have the potential to transform our understanding of atpB's role in Brucella pathogenesis from static, population-averaged observations to dynamic, spatially-resolved insights at the single-cell level.

How might research on atpB contribute to developing new vaccination strategies against brucellosis?

Research on Brucella suis atpB offers several promising avenues for developing novel vaccination strategies against brucellosis. These approaches leverage our understanding of atpB's structure, function, and immunological properties:

1. Attenuated Live Vaccine Strains Based on atpB Modification:
Creating precisely attenuated Brucella strains through strategic modification of atpB could yield effective live vaccines:

  • Engineer strains with controlled attenuation by introducing specific mutations in atpB that maintain immunogenicity while reducing virulence

  • Develop conditional atpB expression systems that allow bacterial replication sufficient for immune priming but prevent long-term persistence

  • This approach is supported by evidence that ATP synthase components play critical roles in acid resistance and intracellular survival

Targeted Attenuation Parameters:

Attenuation ApproachMechanismExpected OutcomeSafety Considerations
Point mutations in proton channelReduced proton translocation efficiencyCompromised acid resistance and energy productionRequires careful balance of attenuation vs. immunogenicity
Regulated expression systemControlled expression timing/levelsInitial replication followed by clearanceMust prevent reversion to constitutive expression
Chimeric atpB variantsModified protein with altered functionStrain-specific attenuationPotential for unexpected interactions

2. Subunit Vaccine Approaches:
Recombinant atpB protein or selected epitopes could serve as components of subunit vaccines:

  • Identify immunodominant B and T cell epitopes from atpB using epitope mapping techniques

  • Design multi-epitope constructs combining atpB epitopes with other immunoprotective antigens

  • Utilize recombinant full-length atpB in adjuvanted formulations to stimulate comprehensive immune responses

  • Test for cross-protection against multiple Brucella species based on conserved epitopes

3. Novel Delivery Systems:
Advanced delivery platforms could enhance the immunogenicity of atpB-based vaccines:

  • Incorporate atpB into outer membrane vesicles (OMVs) to mimic natural presentation while maintaining safety

  • Develop nanoparticle formulations encapsulating atpB to enhance uptake by antigen-presenting cells

  • Design DNA vaccines encoding atpB for in vivo expression and MHC presentation

  • Consider bacterial vectors like attenuated Salmonella expressing Brucella atpB

4. Rational Design Based on Host-Pathogen Interactions:
Insights into atpB's interactions with the immune system can inform vaccine design:

  • Target vaccine design to specifically enhance γ9δ2 T cell responses, which have been shown to limit Brucella replication in macrophages

  • Design constructs that preferentially stimulate protective rather than non-protective immune responses

  • Incorporate understanding of how atpB may participate in immune evasion to overcome these mechanisms

5. Combination Strategies:
Leveraging atpB alongside other Brucella antigens may provide superior protection:

  • Combine atpB with virulence factors identified in screening studies for multi-target protection

  • Include antigens from different subcellular locations (membrane, cytoplasmic, secreted) for comprehensive immunity

  • Develop prime-boost strategies that utilize different atpB presentation platforms for initial priming and subsequent boosting

These vaccination strategies would need to undergo rigorous testing for safety, immunogenicity, and protective efficacy in appropriate animal models before advancing to human trials. The essential nature of atpB and its role in bacterial physiology make it a promising vaccine component that could stimulate protective immunity while minimizing the risk of escape mutations due to functional constraints on the protein.

What are the most significant unresolved questions regarding Brucella suis atpB that merit further investigation?

Despite considerable progress in understanding Brucella suis atpB, several critical knowledge gaps remain that warrant focused research attention. These unresolved questions represent opportunities for significant advances in our understanding of Brucella pathogenesis and potential therapeutic interventions:

1. Structural-Functional Relationships:

  • How does the detailed atomic structure of B. suis atpB differ from homologs in other bacteria, and how do these differences relate to its specialized function in acid resistance?

  • Which specific residues in atpB are essential for proton translocation versus protein-protein interactions within the ATP synthase complex?

  • How does atpB undergo conformational changes during the catalytic cycle, and how are these altered under acidic conditions?

2. Regulation and Adaptation:

  • What are the precise transcriptional and post-translational regulatory mechanisms controlling atpB expression and activity during different stages of infection?

  • How does atpB function change when Brucella transitions between extracellular and intracellular environments?

  • Does atpB play a role in the metabolic adaptation of Brucella to nutrient limitation within the host cell?

3. Immunological Interactions:

  • Does atpB directly interact with host immune components, or is its role in virulence primarily through supporting bacterial metabolism?

  • Are specific regions of atpB recognized by the host immune system, and do these generate protective or non-protective responses?

  • How does atpB contribute to the demonstrated resistance against γ9δ2 T cell-mediated killing mechanisms ?

4. Systems-Level Integration:

5. Therapeutic Targeting:

  • Can atpB be effectively targeted for antimicrobial development without triggering rapid resistance?

  • What are the most promising binding sites on atpB for small molecule inhibitor development?

  • Would targeting atpB synergize with other antimicrobial approaches, particularly those targeting the Tat system which has been shown to be essential ?

6. Evolution and Host Adaptation:

  • How has atpB evolved across Brucella species that infect different hosts, and do these differences contribute to host specificity?

  • Are there human polymorphisms that affect susceptibility to Brucella infection through interactions with bacterial factors including atpB?

  • How conserved is atpB function across the Brucella genus, and what implications does this have for broad-spectrum intervention strategies?

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular genetics, immunology, and systems biology. The answers will not only advance our fundamental understanding of Brucella pathogenesis but could also lead to novel therapeutic and preventive strategies for brucellosis, a significant but neglected zoonotic disease.

What are the key considerations for integrating atpB research findings into broader Brucella pathogenesis models?

Integrating atpB research findings into comprehensive models of Brucella pathogenesis requires careful consideration of multiple factors to ensure accurate contextual placement of this protein's role. Researchers should address the following key considerations:

1. Multifunctional Nature of ATP Synthase:
When incorporating atpB research into pathogenesis models, it's essential to recognize that ATP synthase functions extend beyond simple energy production:

  • Consider dual functionality as both ATP producer and proton pump

  • Acknowledge potential moonlighting functions beyond canonical roles

  • Recognize that different environmental conditions may shift the primary function between ATP synthesis and proton extrusion

  • Avoid oversimplification by addressing both direct and indirect contributions to virulence

2. Systems Biology Integration:
atpB functions within a complex network of cellular processes that collectively determine virulence:

  • Map interactions between energy metabolism, acid resistance, and virulence factor expression

  • Consider temporal dynamics - when different aspects of atpB function become critical during infection

  • Develop mathematical models that incorporate bioenergetic parameters into infection dynamics

  • Use network analysis to identify key control points where atpB influences multiple downstream processes

3. Host-Pathogen Interface Considerations:
The interplay between bacterial factors and host responses must be explicitly addressed:

  • Consider how energy-dependent processes supported by ATP synthase affect host-pathogen interactions

  • Integrate findings on γ9δ2 T cell interactions and other immune responses

  • Address how atpB-dependent activities help overcome specific host defense mechanisms

  • Recognize potential species-specific differences in host responses to Brucella

4. Methodological Limitations:
Critical evaluation of research methods is essential for accurate integration:

  • Assess whether in vitro findings on atpB function translate to in vivo conditions

  • Consider how experimental systems (cell lines, animal models) may affect observed phenotypes

  • Acknowledge limitations of recombinant protein studies versus native protein in membrane context

  • Evaluate whether observed phenotypes of genetic manipulations are direct effects or compensatory responses

5. Translational Research Alignment:
Connect basic research findings to practical applications:

  • Ensure antimicrobial development strategies targeting atpB consider the broader pathogenesis context

  • Align vaccine development approaches with comprehensive immunological understanding

  • Consider diagnostic applications based on atpB conservation across Brucella species

  • Evaluate potential cross-resistance mechanisms when targeting conserved bacterial systems

6. Comparative and Evolutionary Perspective:
Place Brucella atpB research in broader evolutionary context:

  • Compare findings with related Alphaproteobacteria to identify Brucella-specific adaptations

  • Consider how essential systems like ATP synthase and Tat pathway co-evolved

  • Evaluate conservation across Brucella species that infect different hosts

  • Understand how atpB adaptations relate to the evolution of intracellular lifestyle

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.