Recombinant Brucella suis biovar 1 Aquaporin Z (aqpZ)
Shipped with Ice Packs 
In Stock 
Description
Functional Properties
Water channel activity:
-
Facilitates high osmotic water permeability, comparable to mammalian aquaporin-1 () .
-
Low Arrhenius activation energy (), indicating efficient water transport .
Stability:
Vaccine Development
-
Investigated as a potential antigen for Brucella vaccines due to its surface exposure and immunogenicity .
-
Used in preclinical studies to induce immune responses against brucellosis, a zoonotic disease .
Cross-Immunoreactivity Studies
-
Shares structural homology with human aquaporin-4 (AQP4), implicated in neuromyelitis optica (NMO) .
-
Anti-AqpZ antibodies in NMO patient sera suggest molecular mimicry as a disease mechanism .
Biophysical Studies
-
Serves as a model for membrane protein folding and stability due to its SDS-resistant tetrameric structure .
Comparative Analysis
Production and Purification
Key Research Findings
-
Functional Reconstitution:
-
Cell-Free Synthesis:
-
Immunological Cross-Reactivity:
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
aqpZ; BR2001; BS1330_I1995; Aquaporin Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
Target Protein Sequence
MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLSLTVAGRLPAKDLIPYWVAQVLGAIATAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADTAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD
Uniprot No.
Target Background
Function
This protein is responsible for the transport of water across the membrane. It may play a role in adapting to variations in intravacuolar pH or osmolarity.
Database Links
KEGG: bms:BR2001
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
