Recombinant Brucella suis biovar 1 ATP synthase subunit a (atpB) is encoded by the atpB gene (UniProt ID: Q8G2E1) and belongs to the F-type ATP synthase family. It functions as part of a transmembrane proton channel, facilitating ATP synthesis through proton gradient utilization .
| Attribute | Details |
|---|---|
| Source Organism | Brucella suis biovar 1 (strain 1330) |
| Protein Length | Full-length (1–249 amino acids) or partial (varies by product) |
| Molecular Weight | ~28 kDa (estimated) |
| Expression Host | E. coli (common), mammalian cells (alternative) |
| Tag | N-terminal His tag (for purification) |
| Purity | >85%–90% (SDS-PAGE confirmed) |
Function: Integral to ATP synthesis via proton translocation.
Expression: Recombinant production in E. coli or mammalian systems .
Applications: Research into Brucella metabolism, vaccine antigen studies, and diagnostic assays .
The atpB subunit contains conserved motifs critical for proton translocation. Its amino acid sequence includes hydrophobic regions for membrane integration and charged residues for ion channel activity.
Full-Length Sequence (1–249 aa):
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH .
While direct evidence linking atpB to virulence is limited, ATP synthase is essential for Brucella survival in host cells. The enzyme maintains proton gradients for nutrient uptake and replication within intracellular vacuoles .
Brucella manipulates host cell autophagy and endoplasmic reticulum (ER) pathways to establish replication vacuoles (rBCV), where ATP synthase activity may sustain bacterial metabolism .
Mutants lacking ATP synthase subunits exhibit reduced intracellular survival .
Recombinant atpB proteins are under investigation for:
Serological assays: Detecting anti-Brucella antibodies in infected hosts.
Subunit vaccines: While not yet prioritized, ATP synthase subunits could serve as candidates for inducing Th1 immune responses .
| Product | Source | Purity | Length | Tag | Applications |
|---|---|---|---|---|---|
| RFL18151BF | E. coli | >90% | Full-length (1–249 aa) | His | Structural studies |
| CSB-EP818044BMQ1 | E. coli | >85% | Partial | Undetermined | Serological assays |
| CSB-MP818044BMQ1 | Mammalian cells | >85% | Partial | Undetermined | Functional assays |
Structural Complexity: Full-length atpB production in E. coli remains challenging due to hydrophobic regions, necessitating optimization of expression conditions .
Functional Studies: Limited data on atpB’s role in Brucella’s evasion of host immune responses (e.g., inhibition of TLR signaling or macrophage apoptosis) .
Therapeutic Targets: ATP synthase inhibitors (e.g., oligomycin) could disrupt Brucella replication, but specificity remains a concern .
KEGG: bms:BR0382
ATP synthase subunit a (atpB) in Brucella suis likely plays a critical role in bacterial energy metabolism and potentially contributes to virulence mechanisms. While the specific contribution of atpB to pathogenicity hasn't been fully characterized, we know that Brucella species establish persistent infections by evading host immune responses. ATP synthase is essential for bacterial energy production, and its disruption would significantly impair bacterial survival within host cells. Brucella can survive and replicate within dendritic cells (DCs), which are critical components of adaptive immunity and highly susceptible to Brucella infection . The bacterium prevents infected DCs from maturing and impairs their capacity to present antigens to naïve T cells and secrete interleukin-12 . This immunosuppressive activity allows Brucella to establish chronic infections, and ATP generation through the ATP synthase complex would be essential for maintaining these virulence mechanisms.
ATP synthase assembly in Brucella suis likely involves several protein transport systems, with the Twin Arginine Translocation (Tat) system potentially playing a critical role. The Tat system exports folded proteins from the cytosol to the bacterial envelope or extracellular environment . In Brucella suis, the Tat system appears to be essential for viability, as researchers have been unable to create viable Tat system mutants despite multiple strategies . Bioinformatic screening of the B. suis proteome identified 28 proteins with putative Tat signal sequences, of which 20 were confirmed to engage the Tat pathway . While ATP synthase components were not specifically listed among these identified Tat substrates in the search results, the essentiality of the Tat system suggests it may be involved in transporting components necessary for energy metabolism, potentially including ATP synthase assembly or regulation.
For effective expression and purification of recombinant B. suis atpB protein, a multi-faceted approach is recommended:
Expression System Selection: Escherichia coli BL21(DE3) strains are preferred for initial attempts due to their reduced protease activity and efficient T7 RNA polymerase-based expression. Alternative systems including cell-free expression or Brevibacillus should be considered if membrane proteins like atpB present folding challenges.
Vector Optimization: Incorporate a cleavable His6 or Strep-tag for affinity purification. Use low-copy vectors with tunable promoters (like pET vectors with lac operator) to control expression levels and prevent toxicity.
Solubilization Strategy:
| Detergent Type | Concentration Range | Advantages | Limitations |
|---|---|---|---|
| DDM | 0.5-2% | Gentle, maintains activity | Higher CMC |
| LMNG | 0.01-0.1% | Stabilizing, low CMC | Expensive |
| SDS | 0.1-1% | Strong solubilization | Denaturing |
| Digitonin | 0.5-1% | Good for complexes | Natural variation |
Purification Protocol: Implement a three-step approach: IMAC using nickel or cobalt resins for initial capture, followed by ion exchange chromatography for removing contaminants with similar hydrophobicity, and size exclusion chromatography as a final polishing step to isolate homogeneous protein.
Quality Assessment: Verify protein integrity using circular dichroism to assess secondary structure content, thermal shift assays to evaluate stability under different buffer conditions, and dynamic light scattering to confirm monodispersity.
Researchers should be aware that membrane proteins like atpB often require extensive optimization of detergent conditions to maintain native structure. Expression at lower temperatures (16-20°C) and testing multiple constructs with varying N- and C-terminal boundaries can significantly improve yields of functional protein.
The correlation between Brucella suis ATP synthase activity and survival within dendritic cells represents a complex relationship central to pathogenesis. Brucella suis specifically targets dendritic cells (DCs) as a preferential niche for bacterial development and persistence . These infected DCs fail to mature properly and show impaired capabilities to present antigens to naïve T cells, creating an immunological blind spot that facilitates chronic infection .
ATP synthase activity likely plays a critical role in this process by:
Energy Provision: ATP generation would power the cellular machinery required for Brucella to modulate host cell functions, including the Omp25-dependent control of TNF-α production, which is a key mechanism by which Brucella prevents DC maturation .
Acidic Environment Adaptation: Within phagocytic cells, Brucella encounters acidified compartments. ATP synthase may contribute to pH homeostasis, allowing the bacteria to survive these hostile conditions.
Metabolic Flexibility: ATP synthase functionality could enable metabolic adaptations necessary for transition between extracellular and intracellular environments.
Testing this correlation would require developing conditional atpB mutants or specific inhibitors that modulate ATP synthase activity without completely eliminating bacterial viability. Such tools would allow researchers to measure the impact of varied ATP synthase function on:
Bacterial intracellular replication rates
Expression of virulence factors like Omp25
DC maturation markers (CD80, CD86, MHC-II)
Cytokine production profiles (particularly TNF-α and IL-12)
The virulence strategy of Brucella involves targeting DC maturation through TNF-α regulation , and ATP synthase could be an essential metabolic component supporting this immune evasion mechanism.
Comparative analysis of atpB mutations across Brucella strains could reveal fundamental insights into host adaptation mechanisms, particularly concerning energy metabolism adjustments to different host environments. Since Brucella species show distinct host preferences (B. melitensis for small ruminants, B. abortus for cattle, B. suis for swine), variations in atpB might reflect adaptations to specific host metabolic environments.
Key insights could include:
Metabolic Efficiency Variations: Mutations affecting proton translocation efficiency or coupling with the F1 domain might optimize ATP synthase for specific host intracellular conditions, potentially explaining host tropism differences.
Inhibitor Sensitivity Profiles: Different atpB variants might confer varied sensitivity to host antimicrobial compounds that target energy metabolism. For example, B. suis has developed mechanisms for resistance to toxic chemicals through efflux systems like BepC , and ATP synthase variations could similarly contribute to survival strategies.
Temperature Adaptation: Host species have different body temperatures, and atpB mutations might reflect adaptations to optimal function at these specific temperatures.
pH Tolerance Range: Mutations affecting the proton channel function of atpB could influence bacterial survival in acidified phagosomes across different host species.
Methodology for such comparative analysis would require:
Whole genome sequencing of multiple strains from each Brucella species
Structural modeling of atpB variants to predict functional consequences
Experimental validation through complementation studies
In vitro ATP synthesis measurements under conditions mimicking different host environments
This research direction could potentially identify adaptation signatures in atpB that correlate with host specificity, offering new insights into the evolution of host-pathogen relationships in brucellosis.
Generating site-directed mutations in the B. suis atpB gene requires careful consideration of Brucella's genetic characteristics and biosafety requirements. The following comprehensive protocol combines established techniques with Brucella-specific considerations:
Design Strategy:
Identify conserved residues through multiple sequence alignment with related alpha-proteobacteria
Focus on residues in the proton channel or at the interface with other ATP synthase subunits
Design mutations that maintain protein stability while altering specific functions
Plasmid Construction:
Clone the wild-type atpB gene with ~500bp flanking regions into a suicide vector containing a counter-selectable marker (e.g., sacB) and antibiotic resistance marker
Introduce site-specific mutations using overlap extension PCR or commercially available site-directed mutagenesis kits optimized for GC-rich templates
Verify plasmid constructs by sequencing before introduction into Brucella
Transformation Protocol:
Prepare electrocompetent B. suis cells harvested at mid-log phase (OD600 0.6-0.8)
Use electroporation parameters: 2.5kV, 25μF, 400Ω in 0.2cm cuvettes
Immediately recover cells in rich broth (e.g., Brucella broth) for 6-24 hours before plating on selective media
Selection Strategy:
First crossover: Select for plasmid integration using antibiotic resistance
Second crossover: Counter-select on media containing 5-10% sucrose to identify sacB-cured colonies
PCR-screen colonies for the desired mutation and confirm by sequencing
Verification Approaches:
Whole genome sequencing to confirm mutation and exclude off-target effects
Western blotting to verify protein expression levels are comparable to wild-type
Growth curves under various conditions to assess phenotypic effects
Experience from studies with other Brucella genes suggests that suicide vector approaches yield more consistent results than direct allelic replacement methods. Importantly, if atpB proves essential for viability, as observed with the Tat system genes , researchers should consider conditional mutation strategies such as using inducible promoters or creating merodiploid strains before attempting mutation.
To effectively analyze the impact of atpB inhibition on Brucella suis virulence in cellular models, researchers should implement a multi-parameter approach that addresses both bacterial and host cell responses:
Inhibition Strategy Selection:
Chemical inhibition: Use specific ATP synthase inhibitors (oligomycin, venturicidin, or DCCD)
Genetic approaches: Develop inducible antisense RNA systems or CRISPR interference if direct gene knockout isn't viable
Combination approaches: Use sub-inhibitory concentrations of inhibitors with genetic suppression
Cellular Model Selection:
Primary dendritic cells: Critical for studying immune evasion as Brucella specifically targets DCs, preventing their maturation
Macrophage cell lines: THP-1 (human) or RAW264.7 (murine) for standardized infection models
Mixed cell cultures: Co-cultures of epithelial cells and phagocytes to model tissue invasion
Infection Parameters to Monitor:
| Parameter | Technique | Expected Impact of atpB Inhibition |
|---|---|---|
| Bacterial entry | CFU counts at 1-2 hrs post-infection | Minimal effect expected |
| Intracellular replication | CFU counts at 24, 48, 72 hrs | Significant reduction |
| Bacterial trafficking | Confocal microscopy with endosomal markers | Altered phagosome maturation |
| Metabolic activity | Resazurin reduction assay | Decreased metabolic function |
| Membrane potential | DiBAC4(3) fluorescence | Membrane depolarization |
Host Cell Response Analysis:
Flow cytometry to assess DC maturation markers (CD80, CD86, MHC-II)
ELISA for cytokine production (TNF-α, IL-12, IL-6)
RT-qPCR for host gene expression changes
Western blotting for activation of signaling pathways (NF-κB, MAPK)
Methodological Controls:
This approach would allow researchers to distinguish between the direct effects of ATP depletion on bacterial survival versus specific impacts on virulence mechanisms. Since Brucella modulates dendritic cell function through TNF-α suppression mechanisms , particular attention should be paid to whether atpB inhibition affects this immune evasion strategy.
Quantifying ATP synthase activity in recombinant B. suis atpB preparations requires specialized techniques that address the unique challenges of working with membrane proteins. The following methods provide comprehensive assessment of ATP synthase functionality:
ATP Synthesis Activity Measurement:
Luciferin-Luciferase Assay: The gold standard for real-time ATP detection with high sensitivity (detection limit ~10⁻¹² moles ATP)
Protocol modification: Reconstitute purified atpB with other ATP synthase subunits in liposomes containing bacteriorhodopsin to generate proton gradient
Measure luminescence after addition of ADP and Pi in a plate reader format
Include oligomycin controls to verify ATP synthase-specific activity
³²P-ATP Exchange Assay: Measures the incorporation of radiolabeled phosphate into ATP
Advantage: Directly quantifies the reversibility of the ATP synthase reaction
Limitation: Requires radioisotope handling capabilities
Proton Translocation Assessment:
pH-sensitive Fluorescent Dyes: Use ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to monitor pH changes
Reconstitute protein in liposomes and monitor fluorescence quenching upon energization
Calculate proton/ATP ratio by correlating with ATP synthesis rates
Potentiometric Probes: Measure membrane potential using voltage-sensitive dyes (DiSC3, Oxonol V)
Provides complementary data to pH measurements for complete understanding of proton motive force utilization
Structural Integrity Verification:
Native PAGE Analysis: Assess oligomeric state and complex assembly
Crosslinking Studies: Verify interactions between atpB and other subunits
Thermal Stability Assessment: Using differential scanning fluorimetry with various substrates/inhibitors
Data Analysis and Normalization:
| Normalization Method | Advantages | Limitations |
|---|---|---|
| Protein concentration | Standard approach | Doesn't account for inactive protein |
| Western blot quantification | Specific to target protein | Semi-quantitative only |
| ATP hydrolysis correlation | Functional normalization | Assumes coupled functions |
| Reconstitution efficiency | Accounts for incorporation | Technically challenging |
Quality Control Measures:
Perform activity measurements immediately after purification to minimize degradation
Include appropriate positive controls (e.g., E. coli F₁F₀ ATP synthase)
Verify detergent effects by testing multiple conditions (detergent type, concentration)
For the most reliable results, researchers should combine ATP synthesis measurements with proton translocation assays to comprehensively characterize the functional properties of the recombinant atpB preparations.
ATP synthase subunit a (atpB) represents a potentially valuable drug target in Brucella suis that can be compared with other established targets using several critical parameters:
Essentiality Assessment:
AtpB likely has high essentiality similar to the Twin Arginine Translocation (Tat) system, which has been demonstrated to be essential for B. suis viability . Multiple attempts to create Tat system mutants in B. suis were unsuccessful, suggesting its critical role . Similarly, ATP synthase components are typically essential for bacterial viability, particularly in pathogens that rely on oxidative phosphorylation.
Comparative Target Properties:
Virulence Contribution:
While specific data on atpB's contribution to virulence is limited in the search results, we can infer its importance from related findings. The BepC efflux system contributes to B. suis survival inside the host and resistance to toxic compounds . Similarly, ATP synthase function would be critical for providing energy for virulence mechanisms, including the Omp25-dependent control of TNF-α production that prevents dendritic cell maturation .
Target Validation Status:
Compared to well-characterized virulence factors like Omp25, which has been directly linked to inhibition of TNF-α production and DC maturation , atpB requires further validation as a drug target. Experimental evidence connecting ATP synthase inhibition to attenuated virulence would strengthen its candidacy as a therapeutic target.
Druggability Considerations:
The membrane-embedded nature of atpB presents both challenges and opportunities. While this location may complicate drug delivery, the success of bedaquiline (which targets mycobacterial ATP synthase) demonstrates that bacterial ATP synthase can be selectively targeted despite the presence of a mammalian homolog.
The available data suggests that atpB could be a high-value drug target with potential advantages over surface proteins like BepC, which are more prone to resistance development through mutation or efflux system upregulation .
ATP synthase likely plays a multifaceted role in Brucella suis biofilm formation and persistence through several interconnected mechanisms:
Energy Provision for Biofilm Synthesis:
Biofilm formation requires substantial energy expenditure for the production of extracellular polymeric substances (EPS), protein adhesins, and regulatory molecules. ATP synthase would be central to generating the necessary ATP pools to support these energetically demanding processes. The transition from planktonic to biofilm growth involves significant metabolic reprogramming, with ATP serving as the primary energy currency for biosynthetic pathways.
Adaptation to Microenvironmental Conditions:
Biofilms create heterogeneous microenvironments with varying oxygen and nutrient availability gradients. ATP synthase function may be modulated differently in distinct biofilm regions:
Aerobic zones: Conventional oxidative phosphorylation
Microaerobic/anaerobic zones: Possible reverse ATP synthase function to maintain proton motive force
Connection to Persistence Mechanisms:
Brucella's ability to establish persistent infections depends on evading host immune responses. Research has shown that Brucella prevents dendritic cell maturation and impairs their capacity to present antigens to naïve T cells through mechanisms involving the bacterial protein Omp25 . This immune evasion requires energy, and ATP synthase activity would support these virulence functions during biofilm-associated persistence.
Stress Response Integration:
Biofilm bacteria typically display heightened tolerance to antimicrobials and stress conditions. ATP synthase may contribute to stress resistance by:
Potential as Intervention Target:
The critical role of ATP synthase in biofilm formation suggests it could be a valuable target for anti-biofilm strategies. Compounds that modulate ATP synthase activity might disrupt established biofilms or prevent their formation, potentially enhancing the effectiveness of conventional antibiotics against persistent Brucella infections.
Experimental approaches to investigate this connection would include observing biofilm formation under conditions of ATP synthase inhibition, examining ATP synthase expression levels in biofilm versus planktonic cells, and studying the spatial distribution of ATP concentrations within Brucella biofilms.
Structural information about B. suis atpB could significantly inform the development of species-specific inhibitors through multiple avenues:
Unique Binding Pocket Identification:
High-resolution structural data would reveal potential binding sites within the atpB protein that differ from mammalian ATP synthase counterparts. Particular focus should be directed toward:
The proton channel region, which is essential for energy transduction
Interfaces with other ATP synthase subunits that may contain species-specific residues
Allosteric sites that could alter protein conformation upon binding
Structure-Based Rational Design Strategy:
| Structural Feature | Potential Targeting Approach | Anticipated Advantage |
|---|---|---|
| Proton-binding residues | Hydrogen bond disruption | Direct functional inhibition |
| Subunit interfaces | Protein-protein interaction inhibitors | Assembly disruption |
| Brucella-specific motifs | Selective binding compounds | Host enzyme sparing |
| Conformational dynamics | Transition state analogs | Energy coupling disruption |
Comparative Structural Analysis:
Superimposing the B. suis atpB structure with:
Mammalian ATP synthase equivalents to identify exploitable differences
Other bacterial ATP synthases to assess spectrum of activity
Structures from related alpha-proteobacteria to understand evolution of potential binding sites
Molecular Dynamics Simulations:
Computational modeling of atpB dynamics would reveal:
Transient binding pockets not evident in static structures
Flexibility of key regions that could accommodate inhibitors
Water networks and hydrogen bonding patterns critical for function
Integration with Existing Knowledge:
Structural data should be interpreted in the context of known Brucella biology, including:
Validation Approaches:
Structure-based inhibitor design would be validated through:
The success of bedaquiline against mycobacterial ATP synthase demonstrates the feasibility of selectively targeting bacterial ATP synthase despite conservation of this enzyme family. Detailed structural information about B. suis atpB could similarly enable the development of narrow-spectrum agents with minimal host toxicity.
Analyzing atpB function in the context of Brucella suis metabolic adaptation to host environments requires an integrated systems biology approach that examines ATP synthase activity across different infection stages and microenvironments:
Temporal Expression Profiling:
Implementing time-course transcriptomic and proteomic analyses can reveal how atpB expression changes during:
Initial host cell invasion
Phagosomal trafficking and acidification
Establishment of the replicative niche
Persistent infection phase
This would involve RNA-seq and quantitative proteomics from infected cell models at multiple timepoints, with particular focus on dendritic cells, which have been identified as highly susceptible to Brucella infection and a preferential niche for bacterial development .
Metabolic Network Modeling:
Construction of genome-scale metabolic models that incorporate:
ATP production/consumption across different metabolic states
Flux balance analysis under varying nutrient availability conditions
Integration with experimental transcriptomic data to constrain flux predictions
Simulation of atpB inhibition to predict system-wide metabolic consequences
Microenvironment-Specific Analysis:
Development of experimental systems that recreate distinct host microenvironments:
Oxygen-limited models mimicking granuloma-like structures
Nutrient restriction experiments simulating phagosomal conditions
pH-controlled systems to assess ATP synthase function under acidic stress
In Vivo Reporter Systems:
Creation of genetically encoded biosensors to monitor:
Intracellular ATP levels during infection using Förster resonance energy transfer (FRET)-based ATP sensors
Proton motive force fluctuations with voltage-sensitive fluorescent proteins
atpB promoter activity with luminescent or fluorescent reporters
Integration with Immune Evasion Mechanisms:
Investigation of the metabolic requirements for Brucella's immune evasion strategies:
Post-Translational Modification Assessment:
Analysis of potential regulatory modifications of atpB:
This multifaceted approach would provide a comprehensive understanding of how ATP synthase function supports Brucella's remarkable ability to adapt to diverse host environments and maintain persistent infections despite host immune responses.
The development of atpB-targeting vaccines for brucellosis prevention presents several promising avenues with distinct advantages and challenges:
Immunological Rationale:
ATP synthase components represent conserved antigens that are critical for bacterial survival. Targeting atpB in vaccine development offers several theoretical advantages:
Essentiality: As a likely essential protein, escape mutations would severely compromise bacterial fitness
Conservation: The high conservation across Brucella species could provide cross-protection against multiple biovars
Expression consistency: As a core metabolic component, atpB is likely expressed throughout infection stages
Potential Vaccine Platforms:
| Platform Type | Specific Approach | Advantages | Challenges |
|---|---|---|---|
| Subunit vaccine | Recombinant atpB protein | Safety, precise formulation | May require adjuvants |
| DNA vaccine | atpB-encoding plasmids | Strong cellular immunity | Delivery efficiency |
| Live attenuated | atpB expression modulation | Broad immune response | Safety concerns |
| Epitope-based | atpB B-cell/T-cell epitopes | Focused immune response | Epitope selection complexity |
Immune Response Considerations:
An effective atpB-targeting vaccine should induce:
Strong Th1-polarized CD4+ T cell responses, which are critical for protection against Brucella
Cell-mediated immunity targeting infected phagocytes
Potentially neutralizing antibodies if accessible epitopes exist
This approach is particularly relevant given that Brucella specifically targets dendritic cells, preventing their maturation and impairing their capacity to present antigens to T cells .
Delivery Strategy Optimization:
Combination Approaches:
Including atpB with other immunogenic components might enhance protection:
Evaluation Framework:
Vaccine efficacy assessment should include:
Cellular immune response profiling (IFN-γ, IL-2, TNF-α production)
Protection against challenge in appropriate animal models
Duration of protective immunity
Cross-protection against multiple Brucella species
The development of such vaccines would need to address the challenge of generating effective immunity against a pathogen that specifically impairs the function of dendritic cells, which are critical for initiating adaptive immune responses . Strategies that bypass or overcome this immunosuppressive activity would be particularly valuable.
Optimizing high-throughput screening (HTS) approaches for identifying selective atpB inhibitors against Brucella suis requires tailored strategies that address the unique challenges of this target:
Target-Based Screening Design:
| Assay Type | Implementation | Advantages | Considerations |
|---|---|---|---|
| ATP synthesis | Luciferin-luciferase | Direct functional readout | Requires reconstituted system |
| Proton flux | pH-sensitive fluorophores | Mechanism-specific | Complex assay setup |
| Binding assays | Thermal shift, SPR | High throughput | May miss functional inhibitors |
| ATPase coupling | Phosphate release | Simplified biochemistry | Indirect measure |
Cell-Based Phenotypic Screening:
Develop reporter strains with growth-dependent or ATP-level dependent readouts
Implement biosafety-compliant screening using attenuated B. suis strains
Design counter-screens against mammalian cell lines to identify selective compounds
Include monitoring of dendritic cell maturation markers to identify compounds that potentially restore immune function impaired by Brucella infection
Compound Library Considerations:
Prioritize chemical libraries enriched for antibacterial compounds
Include FDA-approved drugs for repurposing potential
Design focused libraries based on known ATP synthase inhibitors
Incorporate natural product collections with historical antimicrobial activity
Innovative Screening Paradigms:
Fragment-based screening to identify building blocks for larger inhibitors
DNA-encoded library technology for massive parallel screening
Computational pre-screening using structural models of B. suis atpB
Activity-based protein profiling to identify compounds that covalently modify atpB
Cascade Validation Strategy:
Integration with Resistance Mechanisms:
Data Analysis Framework:
Machine learning algorithms to identify structure-activity relationships
Pattern recognition to cluster compounds by mechanism of action
Predictive models for pharmacokinetic properties and tissue distribution
This comprehensive approach would increase the probability of identifying compounds with selective activity against B. suis atpB while minimizing off-target effects on host ATP synthase. The goal would be to develop inhibitors that disrupt bacterial energy metabolism without interfering with the host's ability to generate an effective immune response against the pathogen.
Several cutting-edge technologies are poised to revolutionize our understanding of atpB's role in Brucella suis pathogenesis:
CRISPR Interference (CRISPRi) Systems:
The development of tunable gene expression systems using catalytically dead Cas9 (dCas9) could allow precise control of atpB expression levels without complete gene knockout. This approach is particularly valuable since the Tat system has been shown to be essential in B. suis , and ATP synthase components may similarly be essential. CRISPRi would enable researchers to:
Create conditional knockdowns to study atpB function during different infection stages
Establish dose-response relationships between ATP synthase activity and virulence phenotypes
Investigate the minimal ATP synthase activity required for bacterial survival
Single-Cell Technologies:
Next-generation single-cell approaches would reveal heterogeneity in bacterial populations:
Single-cell RNA sequencing of infected host cells to correlate bacterial atpB expression with host response patterns
Spatial transcriptomics to map gene expression within granulomas or tissue lesions
Metabolic imaging using fluorescent biosensors to visualize ATP gradients in individual bacteria within host cells
Cryo-Electron Tomography:
This technique would allow visualization of ATP synthase complexes in near-native states:
Structural arrangement of ATP synthase within the bacterial membrane
Conformational changes associated with active/inactive states
Interactions with other membrane complexes during infection
Host-Pathogen Protein-Protein Interaction Mapping:
Advanced proteomics techniques could identify potential interactions between atpB or ATP synthase components and host proteins:
BioID or APEX2 proximity labeling to identify proteins in close proximity to atpB during infection
Cross-linking mass spectrometry to capture transient interactions
Protein complementation assays to validate specific interactions in vivo
Intravital Microscopy with Genetically Encoded Sensors:
Real-time monitoring of bacterial metabolism in living animals:
ATP FRET sensors to track energy status during infection
pH-sensitive fluorescent proteins to monitor local environment
Calcium indicators to observe signaling events during host-pathogen interactions
Organ-on-a-Chip Models:
Microfluidic devices mimicking complex tissue environments would allow:
Controlled studies of atpB function under physiologically relevant conditions
Observation of bacterial behavior at tissue interfaces
Testing of atpB inhibitors in complex microenvironments replicating granuloma formation
Machine Learning Integration:
Computational approaches to integrate multi-omic datasets:
Predictive modeling of metabolic adaptations dependent on ATP synthase function
Network analysis to place atpB in the context of other virulence mechanisms
Pattern recognition to identify infection signatures associated with ATP synthase activity
These technologies would provide unprecedented insights into how ATP synthase contributes to Brucella's ability to prevent dendritic cell maturation , resist host defense mechanisms , and establish persistent infections. The integration of these approaches could transform our understanding of the fundamental metabolic underpinnings of Brucella pathogenesis.