Recombinant Brucella suis biovar 1 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Brucella suis biovar 1 ATP synthase subunit a (atpB) is encoded by the atpB gene (UniProt ID: Q8G2E1) and belongs to the F-type ATP synthase family. It functions as part of a transmembrane proton channel, facilitating ATP synthesis through proton gradient utilization .

AttributeDetails
Source OrganismBrucella suis biovar 1 (strain 1330)
Protein LengthFull-length (1–249 amino acids) or partial (varies by product)
Molecular Weight~28 kDa (estimated)
Expression HostE. coli (common), mammalian cells (alternative)
TagN-terminal His tag (for purification)
Purity>85%–90% (SDS-PAGE confirmed)

Key Features:

  • Function: Integral to ATP synthesis via proton translocation.

  • Expression: Recombinant production in E. coli or mammalian systems .

  • Applications: Research into Brucella metabolism, vaccine antigen studies, and diagnostic assays .

Protein Structure and Sequence

The atpB subunit contains conserved motifs critical for proton translocation. Its amino acid sequence includes hydrophobic regions for membrane integration and charged residues for ion channel activity.

Full-Length Sequence (1–249 aa):
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH .

Handling Notes:

  • Avoid repeated freeze-thaw cycles.

  • Store at -20°C/-80°C for long-term use .

Role in Brucella Pathogenesis

While direct evidence linking atpB to virulence is limited, ATP synthase is essential for Brucella survival in host cells. The enzyme maintains proton gradients for nutrient uptake and replication within intracellular vacuoles .

Key Findings:

  • Brucella manipulates host cell autophagy and endoplasmic reticulum (ER) pathways to establish replication vacuoles (rBCV), where ATP synthase activity may sustain bacterial metabolism .

  • Mutants lacking ATP synthase subunits exhibit reduced intracellular survival .

Diagnostic and Vaccine Potential

Recombinant atpB proteins are under investigation for:

  • Serological assays: Detecting anti-Brucella antibodies in infected hosts.

  • Subunit vaccines: While not yet prioritized, ATP synthase subunits could serve as candidates for inducing Th1 immune responses .

Comparison of Recombinant Proteins:

ProductSourcePurityLengthTagApplications
RFL18151BFE. coli>90%Full-length (1–249 aa)HisStructural studies
CSB-EP818044BMQ1E. coli>85%PartialUndeterminedSerological assays
CSB-MP818044BMQ1Mammalian cells>85%PartialUndeterminedFunctional assays

Data sourced from .

Challenges and Future Directions

  • Structural Complexity: Full-length atpB production in E. coli remains challenging due to hydrophobic regions, necessitating optimization of expression conditions .

  • Functional Studies: Limited data on atpB’s role in Brucella’s evasion of host immune responses (e.g., inhibition of TLR signaling or macrophage apoptosis) .

  • Therapeutic Targets: ATP synthase inhibitors (e.g., oligomycin) could disrupt Brucella replication, but specificity remains a concern .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; BR0382; BS1330_I0383; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
atpB
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: bms:BR0382

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Brucella suis virulence?

ATP synthase subunit a (atpB) in Brucella suis likely plays a critical role in bacterial energy metabolism and potentially contributes to virulence mechanisms. While the specific contribution of atpB to pathogenicity hasn't been fully characterized, we know that Brucella species establish persistent infections by evading host immune responses. ATP synthase is essential for bacterial energy production, and its disruption would significantly impair bacterial survival within host cells. Brucella can survive and replicate within dendritic cells (DCs), which are critical components of adaptive immunity and highly susceptible to Brucella infection . The bacterium prevents infected DCs from maturing and impairs their capacity to present antigens to naïve T cells and secrete interleukin-12 . This immunosuppressive activity allows Brucella to establish chronic infections, and ATP generation through the ATP synthase complex would be essential for maintaining these virulence mechanisms.

What protein transport systems might be involved in ATP synthase assembly in Brucella suis?

ATP synthase assembly in Brucella suis likely involves several protein transport systems, with the Twin Arginine Translocation (Tat) system potentially playing a critical role. The Tat system exports folded proteins from the cytosol to the bacterial envelope or extracellular environment . In Brucella suis, the Tat system appears to be essential for viability, as researchers have been unable to create viable Tat system mutants despite multiple strategies . Bioinformatic screening of the B. suis proteome identified 28 proteins with putative Tat signal sequences, of which 20 were confirmed to engage the Tat pathway . While ATP synthase components were not specifically listed among these identified Tat substrates in the search results, the essentiality of the Tat system suggests it may be involved in transporting components necessary for energy metabolism, potentially including ATP synthase assembly or regulation.

What experimental approaches are most effective for expressing and purifying recombinant B. suis atpB protein for structural studies?

For effective expression and purification of recombinant B. suis atpB protein, a multi-faceted approach is recommended:

  • Expression System Selection: Escherichia coli BL21(DE3) strains are preferred for initial attempts due to their reduced protease activity and efficient T7 RNA polymerase-based expression. Alternative systems including cell-free expression or Brevibacillus should be considered if membrane proteins like atpB present folding challenges.

  • Vector Optimization: Incorporate a cleavable His6 or Strep-tag for affinity purification. Use low-copy vectors with tunable promoters (like pET vectors with lac operator) to control expression levels and prevent toxicity.

  • Solubilization Strategy:

    Detergent TypeConcentration RangeAdvantagesLimitations
    DDM0.5-2%Gentle, maintains activityHigher CMC
    LMNG0.01-0.1%Stabilizing, low CMCExpensive
    SDS0.1-1%Strong solubilizationDenaturing
    Digitonin0.5-1%Good for complexesNatural variation
  • Purification Protocol: Implement a three-step approach: IMAC using nickel or cobalt resins for initial capture, followed by ion exchange chromatography for removing contaminants with similar hydrophobicity, and size exclusion chromatography as a final polishing step to isolate homogeneous protein.

  • Quality Assessment: Verify protein integrity using circular dichroism to assess secondary structure content, thermal shift assays to evaluate stability under different buffer conditions, and dynamic light scattering to confirm monodispersity.

Researchers should be aware that membrane proteins like atpB often require extensive optimization of detergent conditions to maintain native structure. Expression at lower temperatures (16-20°C) and testing multiple constructs with varying N- and C-terminal boundaries can significantly improve yields of functional protein.

How does Brucella suis ATP synthase activity correlate with bacterial survival within dendritic cells?

The correlation between Brucella suis ATP synthase activity and survival within dendritic cells represents a complex relationship central to pathogenesis. Brucella suis specifically targets dendritic cells (DCs) as a preferential niche for bacterial development and persistence . These infected DCs fail to mature properly and show impaired capabilities to present antigens to naïve T cells, creating an immunological blind spot that facilitates chronic infection .

ATP synthase activity likely plays a critical role in this process by:

  • Energy Provision: ATP generation would power the cellular machinery required for Brucella to modulate host cell functions, including the Omp25-dependent control of TNF-α production, which is a key mechanism by which Brucella prevents DC maturation .

  • Acidic Environment Adaptation: Within phagocytic cells, Brucella encounters acidified compartments. ATP synthase may contribute to pH homeostasis, allowing the bacteria to survive these hostile conditions.

  • Metabolic Flexibility: ATP synthase functionality could enable metabolic adaptations necessary for transition between extracellular and intracellular environments.

Testing this correlation would require developing conditional atpB mutants or specific inhibitors that modulate ATP synthase activity without completely eliminating bacterial viability. Such tools would allow researchers to measure the impact of varied ATP synthase function on:

  • Bacterial intracellular replication rates

  • Expression of virulence factors like Omp25

  • DC maturation markers (CD80, CD86, MHC-II)

  • Cytokine production profiles (particularly TNF-α and IL-12)

The virulence strategy of Brucella involves targeting DC maturation through TNF-α regulation , and ATP synthase could be an essential metabolic component supporting this immune evasion mechanism.

What potential insights could comparative analysis of atpB mutations in different Brucella strains provide about host adaptation?

Comparative analysis of atpB mutations across Brucella strains could reveal fundamental insights into host adaptation mechanisms, particularly concerning energy metabolism adjustments to different host environments. Since Brucella species show distinct host preferences (B. melitensis for small ruminants, B. abortus for cattle, B. suis for swine), variations in atpB might reflect adaptations to specific host metabolic environments.

Key insights could include:

  • Metabolic Efficiency Variations: Mutations affecting proton translocation efficiency or coupling with the F1 domain might optimize ATP synthase for specific host intracellular conditions, potentially explaining host tropism differences.

  • Inhibitor Sensitivity Profiles: Different atpB variants might confer varied sensitivity to host antimicrobial compounds that target energy metabolism. For example, B. suis has developed mechanisms for resistance to toxic chemicals through efflux systems like BepC , and ATP synthase variations could similarly contribute to survival strategies.

  • Temperature Adaptation: Host species have different body temperatures, and atpB mutations might reflect adaptations to optimal function at these specific temperatures.

  • pH Tolerance Range: Mutations affecting the proton channel function of atpB could influence bacterial survival in acidified phagosomes across different host species.

Methodology for such comparative analysis would require:

  • Whole genome sequencing of multiple strains from each Brucella species

  • Structural modeling of atpB variants to predict functional consequences

  • Experimental validation through complementation studies

  • In vitro ATP synthesis measurements under conditions mimicking different host environments

This research direction could potentially identify adaptation signatures in atpB that correlate with host specificity, offering new insights into the evolution of host-pathogen relationships in brucellosis.

What are the most effective protocols for generating site-directed mutations in B. suis atpB gene?

Generating site-directed mutations in the B. suis atpB gene requires careful consideration of Brucella's genetic characteristics and biosafety requirements. The following comprehensive protocol combines established techniques with Brucella-specific considerations:

  • Design Strategy:

    • Identify conserved residues through multiple sequence alignment with related alpha-proteobacteria

    • Focus on residues in the proton channel or at the interface with other ATP synthase subunits

    • Design mutations that maintain protein stability while altering specific functions

  • Plasmid Construction:

    • Clone the wild-type atpB gene with ~500bp flanking regions into a suicide vector containing a counter-selectable marker (e.g., sacB) and antibiotic resistance marker

    • Introduce site-specific mutations using overlap extension PCR or commercially available site-directed mutagenesis kits optimized for GC-rich templates

    • Verify plasmid constructs by sequencing before introduction into Brucella

  • Transformation Protocol:

    • Prepare electrocompetent B. suis cells harvested at mid-log phase (OD600 0.6-0.8)

    • Use electroporation parameters: 2.5kV, 25μF, 400Ω in 0.2cm cuvettes

    • Immediately recover cells in rich broth (e.g., Brucella broth) for 6-24 hours before plating on selective media

  • Selection Strategy:

    • First crossover: Select for plasmid integration using antibiotic resistance

    • Second crossover: Counter-select on media containing 5-10% sucrose to identify sacB-cured colonies

    • PCR-screen colonies for the desired mutation and confirm by sequencing

  • Verification Approaches:

    • Whole genome sequencing to confirm mutation and exclude off-target effects

    • Western blotting to verify protein expression levels are comparable to wild-type

    • Growth curves under various conditions to assess phenotypic effects

Experience from studies with other Brucella genes suggests that suicide vector approaches yield more consistent results than direct allelic replacement methods. Importantly, if atpB proves essential for viability, as observed with the Tat system genes , researchers should consider conditional mutation strategies such as using inducible promoters or creating merodiploid strains before attempting mutation.

How can researchers effectively analyze the impact of atpB inhibition on Brucella suis virulence in cellular models?

To effectively analyze the impact of atpB inhibition on Brucella suis virulence in cellular models, researchers should implement a multi-parameter approach that addresses both bacterial and host cell responses:

  • Inhibition Strategy Selection:

    • Chemical inhibition: Use specific ATP synthase inhibitors (oligomycin, venturicidin, or DCCD)

    • Genetic approaches: Develop inducible antisense RNA systems or CRISPR interference if direct gene knockout isn't viable

    • Combination approaches: Use sub-inhibitory concentrations of inhibitors with genetic suppression

  • Cellular Model Selection:

    • Primary dendritic cells: Critical for studying immune evasion as Brucella specifically targets DCs, preventing their maturation

    • Macrophage cell lines: THP-1 (human) or RAW264.7 (murine) for standardized infection models

    • Mixed cell cultures: Co-cultures of epithelial cells and phagocytes to model tissue invasion

  • Infection Parameters to Monitor:

    ParameterTechniqueExpected Impact of atpB Inhibition
    Bacterial entryCFU counts at 1-2 hrs post-infectionMinimal effect expected
    Intracellular replicationCFU counts at 24, 48, 72 hrsSignificant reduction
    Bacterial traffickingConfocal microscopy with endosomal markersAltered phagosome maturation
    Metabolic activityResazurin reduction assayDecreased metabolic function
    Membrane potentialDiBAC4(3) fluorescenceMembrane depolarization
  • Host Cell Response Analysis:

    • Flow cytometry to assess DC maturation markers (CD80, CD86, MHC-II)

    • ELISA for cytokine production (TNF-α, IL-12, IL-6)

    • RT-qPCR for host gene expression changes

    • Western blotting for activation of signaling pathways (NF-κB, MAPK)

  • Methodological Controls:

    • Include heat-killed bacteria and known attenuated strains (e.g., virB mutants)

    • Test efflux pump mutants (e.g., BepC ) to distinguish ATP depletion effects from drug accumulation

    • Monitor host cell viability to ensure observed effects aren't due to cytotoxicity

This approach would allow researchers to distinguish between the direct effects of ATP depletion on bacterial survival versus specific impacts on virulence mechanisms. Since Brucella modulates dendritic cell function through TNF-α suppression mechanisms , particular attention should be paid to whether atpB inhibition affects this immune evasion strategy.

What techniques are most reliable for quantifying ATP synthase activity in recombinant B. suis atpB preparations?

Quantifying ATP synthase activity in recombinant B. suis atpB preparations requires specialized techniques that address the unique challenges of working with membrane proteins. The following methods provide comprehensive assessment of ATP synthase functionality:

  • ATP Synthesis Activity Measurement:

    • Luciferin-Luciferase Assay: The gold standard for real-time ATP detection with high sensitivity (detection limit ~10⁻¹² moles ATP)

      • Protocol modification: Reconstitute purified atpB with other ATP synthase subunits in liposomes containing bacteriorhodopsin to generate proton gradient

      • Measure luminescence after addition of ADP and Pi in a plate reader format

      • Include oligomycin controls to verify ATP synthase-specific activity

    • ⁣³²P-ATP Exchange Assay: Measures the incorporation of radiolabeled phosphate into ATP

      • Advantage: Directly quantifies the reversibility of the ATP synthase reaction

      • Limitation: Requires radioisotope handling capabilities

  • Proton Translocation Assessment:

    • pH-sensitive Fluorescent Dyes: Use ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to monitor pH changes

      • Reconstitute protein in liposomes and monitor fluorescence quenching upon energization

      • Calculate proton/ATP ratio by correlating with ATP synthesis rates

    • Potentiometric Probes: Measure membrane potential using voltage-sensitive dyes (DiSC3, Oxonol V)

      • Provides complementary data to pH measurements for complete understanding of proton motive force utilization

  • Structural Integrity Verification:

    • Native PAGE Analysis: Assess oligomeric state and complex assembly

    • Crosslinking Studies: Verify interactions between atpB and other subunits

    • Thermal Stability Assessment: Using differential scanning fluorimetry with various substrates/inhibitors

  • Data Analysis and Normalization:

    Normalization MethodAdvantagesLimitations
    Protein concentrationStandard approachDoesn't account for inactive protein
    Western blot quantificationSpecific to target proteinSemi-quantitative only
    ATP hydrolysis correlationFunctional normalizationAssumes coupled functions
    Reconstitution efficiencyAccounts for incorporationTechnically challenging
  • Quality Control Measures:

    • Perform activity measurements immediately after purification to minimize degradation

    • Include appropriate positive controls (e.g., E. coli F₁F₀ ATP synthase)

    • Verify detergent effects by testing multiple conditions (detergent type, concentration)

For the most reliable results, researchers should combine ATP synthesis measurements with proton translocation assays to comprehensively characterize the functional properties of the recombinant atpB preparations.

How does atpB compare to other potential drug targets in Brucella suis?

ATP synthase subunit a (atpB) represents a potentially valuable drug target in Brucella suis that can be compared with other established targets using several critical parameters:

  • Essentiality Assessment:
    AtpB likely has high essentiality similar to the Twin Arginine Translocation (Tat) system, which has been demonstrated to be essential for B. suis viability . Multiple attempts to create Tat system mutants in B. suis were unsuccessful, suggesting its critical role . Similarly, ATP synthase components are typically essential for bacterial viability, particularly in pathogens that rely on oxidative phosphorylation.

  • Comparative Target Properties:

    TargetEssentialityAccessibilityHost HomologyResistance PotentialCurrent Development
    atpB (ATP synthase)HighModerate (membrane)ModerateLow-ModerateLimited
    Tat systemHigh Good (periplasmic)LowUnknownEarly stage
    BepC (TolC homolog)Moderate Excellent (surface)LowHighLimited
    VirB systemModerate for virulenceGoodLowLowModerate
    Omp25High for virulence Excellent (surface)NoneLowModerate
  • Virulence Contribution:
    While specific data on atpB's contribution to virulence is limited in the search results, we can infer its importance from related findings. The BepC efflux system contributes to B. suis survival inside the host and resistance to toxic compounds . Similarly, ATP synthase function would be critical for providing energy for virulence mechanisms, including the Omp25-dependent control of TNF-α production that prevents dendritic cell maturation .

  • Target Validation Status:
    Compared to well-characterized virulence factors like Omp25, which has been directly linked to inhibition of TNF-α production and DC maturation , atpB requires further validation as a drug target. Experimental evidence connecting ATP synthase inhibition to attenuated virulence would strengthen its candidacy as a therapeutic target.

  • Druggability Considerations:
    The membrane-embedded nature of atpB presents both challenges and opportunities. While this location may complicate drug delivery, the success of bedaquiline (which targets mycobacterial ATP synthase) demonstrates that bacterial ATP synthase can be selectively targeted despite the presence of a mammalian homolog.

The available data suggests that atpB could be a high-value drug target with potential advantages over surface proteins like BepC, which are more prone to resistance development through mutation or efflux system upregulation .

What role might ATP synthase play in Brucella suis biofilm formation and persistence?

ATP synthase likely plays a multifaceted role in Brucella suis biofilm formation and persistence through several interconnected mechanisms:

  • Energy Provision for Biofilm Synthesis:
    Biofilm formation requires substantial energy expenditure for the production of extracellular polymeric substances (EPS), protein adhesins, and regulatory molecules. ATP synthase would be central to generating the necessary ATP pools to support these energetically demanding processes. The transition from planktonic to biofilm growth involves significant metabolic reprogramming, with ATP serving as the primary energy currency for biosynthetic pathways.

  • Adaptation to Microenvironmental Conditions:
    Biofilms create heterogeneous microenvironments with varying oxygen and nutrient availability gradients. ATP synthase function may be modulated differently in distinct biofilm regions:

    • Aerobic zones: Conventional oxidative phosphorylation

    • Microaerobic/anaerobic zones: Possible reverse ATP synthase function to maintain proton motive force

  • Connection to Persistence Mechanisms:
    Brucella's ability to establish persistent infections depends on evading host immune responses. Research has shown that Brucella prevents dendritic cell maturation and impairs their capacity to present antigens to naïve T cells through mechanisms involving the bacterial protein Omp25 . This immune evasion requires energy, and ATP synthase activity would support these virulence functions during biofilm-associated persistence.

  • Stress Response Integration:
    Biofilm bacteria typically display heightened tolerance to antimicrobials and stress conditions. ATP synthase may contribute to stress resistance by:

    • Maintaining cellular energy levels during nutrient limitation

    • Supporting energy-dependent efflux systems like BepC, which is involved in resistance to various toxic compounds and contributes to B. suis survival inside the host

    • Powering stress response pathways that maintain cellular homeostasis

  • Potential as Intervention Target:
    The critical role of ATP synthase in biofilm formation suggests it could be a valuable target for anti-biofilm strategies. Compounds that modulate ATP synthase activity might disrupt established biofilms or prevent their formation, potentially enhancing the effectiveness of conventional antibiotics against persistent Brucella infections.

Experimental approaches to investigate this connection would include observing biofilm formation under conditions of ATP synthase inhibition, examining ATP synthase expression levels in biofilm versus planktonic cells, and studying the spatial distribution of ATP concentrations within Brucella biofilms.

How could structural information about B. suis atpB inform the development of species-specific inhibitors?

Structural information about B. suis atpB could significantly inform the development of species-specific inhibitors through multiple avenues:

  • Unique Binding Pocket Identification:
    High-resolution structural data would reveal potential binding sites within the atpB protein that differ from mammalian ATP synthase counterparts. Particular focus should be directed toward:

    • The proton channel region, which is essential for energy transduction

    • Interfaces with other ATP synthase subunits that may contain species-specific residues

    • Allosteric sites that could alter protein conformation upon binding

  • Structure-Based Rational Design Strategy:

    Structural FeaturePotential Targeting ApproachAnticipated Advantage
    Proton-binding residuesHydrogen bond disruptionDirect functional inhibition
    Subunit interfacesProtein-protein interaction inhibitorsAssembly disruption
    Brucella-specific motifsSelective binding compoundsHost enzyme sparing
    Conformational dynamicsTransition state analogsEnergy coupling disruption
  • Comparative Structural Analysis:
    Superimposing the B. suis atpB structure with:

    • Mammalian ATP synthase equivalents to identify exploitable differences

    • Other bacterial ATP synthases to assess spectrum of activity

    • Structures from related alpha-proteobacteria to understand evolution of potential binding sites

  • Molecular Dynamics Simulations:
    Computational modeling of atpB dynamics would reveal:

    • Transient binding pockets not evident in static structures

    • Flexibility of key regions that could accommodate inhibitors

    • Water networks and hydrogen bonding patterns critical for function

  • Integration with Existing Knowledge:
    Structural data should be interpreted in the context of known Brucella biology, including:

    • The essentiality of energy metabolism for intracellular survival

    • The possible connection to virulence mechanisms like the Omp25-dependent inhibition of TNF-α production in dendritic cells

    • Potential interactions with other essential systems like the Twin Arginine Translocation (Tat) pathway

  • Validation Approaches:
    Structure-based inhibitor design would be validated through:

    • In vitro ATP synthesis assays using purified components

    • Cellular infection models to confirm inhibition of B. suis growth within dendritic cells

    • Selectivity testing against mammalian ATP synthase

    • Assessment of resistance development potential through mutation frequency analysis

The success of bedaquiline against mycobacterial ATP synthase demonstrates the feasibility of selectively targeting bacterial ATP synthase despite conservation of this enzyme family. Detailed structural information about B. suis atpB could similarly enable the development of narrow-spectrum agents with minimal host toxicity.

How might atpB function be analyzed in the context of Brucella suis metabolic adaptation to host environments?

Analyzing atpB function in the context of Brucella suis metabolic adaptation to host environments requires an integrated systems biology approach that examines ATP synthase activity across different infection stages and microenvironments:

  • Temporal Expression Profiling:
    Implementing time-course transcriptomic and proteomic analyses can reveal how atpB expression changes during:

    • Initial host cell invasion

    • Phagosomal trafficking and acidification

    • Establishment of the replicative niche

    • Persistent infection phase

    This would involve RNA-seq and quantitative proteomics from infected cell models at multiple timepoints, with particular focus on dendritic cells, which have been identified as highly susceptible to Brucella infection and a preferential niche for bacterial development .

  • Metabolic Network Modeling:
    Construction of genome-scale metabolic models that incorporate:

    • ATP production/consumption across different metabolic states

    • Flux balance analysis under varying nutrient availability conditions

    • Integration with experimental transcriptomic data to constrain flux predictions

    • Simulation of atpB inhibition to predict system-wide metabolic consequences

  • Microenvironment-Specific Analysis:
    Development of experimental systems that recreate distinct host microenvironments:

    • Oxygen-limited models mimicking granuloma-like structures

    • Nutrient restriction experiments simulating phagosomal conditions

    • pH-controlled systems to assess ATP synthase function under acidic stress

  • In Vivo Reporter Systems:
    Creation of genetically encoded biosensors to monitor:

    • Intracellular ATP levels during infection using Förster resonance energy transfer (FRET)-based ATP sensors

    • Proton motive force fluctuations with voltage-sensitive fluorescent proteins

    • atpB promoter activity with luminescent or fluorescent reporters

  • Integration with Immune Evasion Mechanisms:
    Investigation of the metabolic requirements for Brucella's immune evasion strategies:

    • Energy dependency of Omp25-mediated inhibition of TNF-α production in dendritic cells

    • ATP demands for maintaining the virB type IV secretion system

    • Metabolic cost of resistance mechanisms involving efflux systems like BepC

  • Post-Translational Modification Assessment:
    Analysis of potential regulatory modifications of atpB:

    • Phosphorylation status under different infection conditions

    • Potential regulation by the Twin Arginine Translocation system, which has been shown to be essential in B. suis

    • Protein-protein interactions that might modulate ATP synthase activity

This multifaceted approach would provide a comprehensive understanding of how ATP synthase function supports Brucella's remarkable ability to adapt to diverse host environments and maintain persistent infections despite host immune responses.

What potential lies in developing atpB-targeting vaccines for brucellosis prevention?

The development of atpB-targeting vaccines for brucellosis prevention presents several promising avenues with distinct advantages and challenges:

  • Immunological Rationale:
    ATP synthase components represent conserved antigens that are critical for bacterial survival. Targeting atpB in vaccine development offers several theoretical advantages:

    • Essentiality: As a likely essential protein, escape mutations would severely compromise bacterial fitness

    • Conservation: The high conservation across Brucella species could provide cross-protection against multiple biovars

    • Expression consistency: As a core metabolic component, atpB is likely expressed throughout infection stages

  • Potential Vaccine Platforms:

    Platform TypeSpecific ApproachAdvantagesChallenges
    Subunit vaccineRecombinant atpB proteinSafety, precise formulationMay require adjuvants
    DNA vaccineatpB-encoding plasmidsStrong cellular immunityDelivery efficiency
    Live attenuatedatpB expression modulationBroad immune responseSafety concerns
    Epitope-basedatpB B-cell/T-cell epitopesFocused immune responseEpitope selection complexity
  • Immune Response Considerations:
    An effective atpB-targeting vaccine should induce:

    • Strong Th1-polarized CD4+ T cell responses, which are critical for protection against Brucella

    • Cell-mediated immunity targeting infected phagocytes

    • Potentially neutralizing antibodies if accessible epitopes exist

    This approach is particularly relevant given that Brucella specifically targets dendritic cells, preventing their maturation and impairing their capacity to present antigens to T cells .

  • Delivery Strategy Optimization:

    • Incorporation into liposomes or nanoparticles to enhance delivery to antigen-presenting cells

    • Co-delivery with adjuvants that promote DC maturation, potentially overcoming Brucella's inhibition of DC function

    • Mucosal delivery systems targeting common entry routes of Brucella

  • Combination Approaches:
    Including atpB with other immunogenic components might enhance protection:

    • Omp25, which plays a key role in virulence by controlling TNF-α production

    • BepC, involved in resistance to various toxic compounds and host survival

    • Components of the Tat system, which is essential for Brucella viability

  • Evaluation Framework:
    Vaccine efficacy assessment should include:

    • Cellular immune response profiling (IFN-γ, IL-2, TNF-α production)

    • Protection against challenge in appropriate animal models

    • Duration of protective immunity

    • Cross-protection against multiple Brucella species

The development of such vaccines would need to address the challenge of generating effective immunity against a pathogen that specifically impairs the function of dendritic cells, which are critical for initiating adaptive immune responses . Strategies that bypass or overcome this immunosuppressive activity would be particularly valuable.

How might high-throughput screening approaches be optimized to identify atpB inhibitors with selective activity against Brucella suis?

Optimizing high-throughput screening (HTS) approaches for identifying selective atpB inhibitors against Brucella suis requires tailored strategies that address the unique challenges of this target:

  • Target-Based Screening Design:

    Assay TypeImplementationAdvantagesConsiderations
    ATP synthesisLuciferin-luciferaseDirect functional readoutRequires reconstituted system
    Proton fluxpH-sensitive fluorophoresMechanism-specificComplex assay setup
    Binding assaysThermal shift, SPRHigh throughputMay miss functional inhibitors
    ATPase couplingPhosphate releaseSimplified biochemistryIndirect measure
  • Cell-Based Phenotypic Screening:

    • Develop reporter strains with growth-dependent or ATP-level dependent readouts

    • Implement biosafety-compliant screening using attenuated B. suis strains

    • Design counter-screens against mammalian cell lines to identify selective compounds

    • Include monitoring of dendritic cell maturation markers to identify compounds that potentially restore immune function impaired by Brucella infection

  • Compound Library Considerations:

    • Prioritize chemical libraries enriched for antibacterial compounds

    • Include FDA-approved drugs for repurposing potential

    • Design focused libraries based on known ATP synthase inhibitors

    • Incorporate natural product collections with historical antimicrobial activity

  • Innovative Screening Paradigms:

    • Fragment-based screening to identify building blocks for larger inhibitors

    • DNA-encoded library technology for massive parallel screening

    • Computational pre-screening using structural models of B. suis atpB

    • Activity-based protein profiling to identify compounds that covalently modify atpB

  • Cascade Validation Strategy:

    • Primary screen: ATP synthesis inhibition or growth inhibition

    • Secondary assays: Selectivity against mammalian ATP synthase

    • Tertiary assays: Activity in cellular infection models, particularly in dendritic cells

    • Safety assessment: Cytotoxicity, mitochondrial function in mammalian cells

  • Integration with Resistance Mechanisms:

    • Include efflux pump inhibitors in screening to prevent false negatives

    • Test compound activity against BepC mutants to identify substrates of this efflux system

    • Assess membrane permeability effects to distinguish true atpB inhibitors from membrane disruptors

  • Data Analysis Framework:

    • Machine learning algorithms to identify structure-activity relationships

    • Pattern recognition to cluster compounds by mechanism of action

    • Predictive models for pharmacokinetic properties and tissue distribution

This comprehensive approach would increase the probability of identifying compounds with selective activity against B. suis atpB while minimizing off-target effects on host ATP synthase. The goal would be to develop inhibitors that disrupt bacterial energy metabolism without interfering with the host's ability to generate an effective immune response against the pathogen.

What emerging technologies could advance our understanding of atpB's role in Brucella suis pathogenesis?

Several cutting-edge technologies are poised to revolutionize our understanding of atpB's role in Brucella suis pathogenesis:

  • CRISPR Interference (CRISPRi) Systems:
    The development of tunable gene expression systems using catalytically dead Cas9 (dCas9) could allow precise control of atpB expression levels without complete gene knockout. This approach is particularly valuable since the Tat system has been shown to be essential in B. suis , and ATP synthase components may similarly be essential. CRISPRi would enable researchers to:

    • Create conditional knockdowns to study atpB function during different infection stages

    • Establish dose-response relationships between ATP synthase activity and virulence phenotypes

    • Investigate the minimal ATP synthase activity required for bacterial survival

  • Single-Cell Technologies:
    Next-generation single-cell approaches would reveal heterogeneity in bacterial populations:

    • Single-cell RNA sequencing of infected host cells to correlate bacterial atpB expression with host response patterns

    • Spatial transcriptomics to map gene expression within granulomas or tissue lesions

    • Metabolic imaging using fluorescent biosensors to visualize ATP gradients in individual bacteria within host cells

  • Cryo-Electron Tomography:
    This technique would allow visualization of ATP synthase complexes in near-native states:

    • Structural arrangement of ATP synthase within the bacterial membrane

    • Conformational changes associated with active/inactive states

    • Interactions with other membrane complexes during infection

  • Host-Pathogen Protein-Protein Interaction Mapping:
    Advanced proteomics techniques could identify potential interactions between atpB or ATP synthase components and host proteins:

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to atpB during infection

    • Cross-linking mass spectrometry to capture transient interactions

    • Protein complementation assays to validate specific interactions in vivo

  • Intravital Microscopy with Genetically Encoded Sensors:
    Real-time monitoring of bacterial metabolism in living animals:

    • ATP FRET sensors to track energy status during infection

    • pH-sensitive fluorescent proteins to monitor local environment

    • Calcium indicators to observe signaling events during host-pathogen interactions

  • Organ-on-a-Chip Models:
    Microfluidic devices mimicking complex tissue environments would allow:

    • Controlled studies of atpB function under physiologically relevant conditions

    • Observation of bacterial behavior at tissue interfaces

    • Testing of atpB inhibitors in complex microenvironments replicating granuloma formation

  • Machine Learning Integration:
    Computational approaches to integrate multi-omic datasets:

    • Predictive modeling of metabolic adaptations dependent on ATP synthase function

    • Network analysis to place atpB in the context of other virulence mechanisms

    • Pattern recognition to identify infection signatures associated with ATP synthase activity

These technologies would provide unprecedented insights into how ATP synthase contributes to Brucella's ability to prevent dendritic cell maturation , resist host defense mechanisms , and establish persistent infections. The integration of these approaches could transform our understanding of the fundamental metabolic underpinnings of Brucella pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.