Recombinant Brucella suis biovar 1 Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Functional Role:

  • Mediates periplasmic accumulation of cyclic β-1,2-glucans, critical for osmoregulation and intracellular survival in host cells .

  • Mutants lacking functional NdvA show reduced motility, impaired nodulation (in rhizobia), and attenuated virulence in Brucella .

Recombinant Expression and Purification

Recombinant NdvA is typically expressed in Escherichia coli with an N-terminal His-tag for purification. Key specifications include:

ParameterValueSource
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS + 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water + glycerol

Genomic and Phylogenetic Context

  • The ndvA gene is chromosomally encoded and adjacent to ndvB in Brucella spp., mirroring the genetic organization in S. meliloti and A. tumefaciens .

  • Comparative genomics reveals 98–100% nucleotide identity between B. suis biovar 1 and B. melitensis homologs, suggesting functional conservation .

  • In B. suis biovar 1, ndvA is part of a minimal genome region differentiating it from other biovars, such as biovar 2 (adapted to hares) and biovar 5 (rodent-associated) .

Vaccine Development:

  • Recombinant NdvA is a candidate antigen for subunit vaccines due to its surface exposure and role in virulence .

  • In murine models, immunization with NdvA homologs (e.g., Dps protein) induced protective immunity against B. melitensis .

Diagnostic Assays:

  • NdvA epitopes are evaluated in DIVA (Differentiating Infected from Vaccinated Animals) assays to distinguish natural infections from vaccine strains like B. abortus S19 .

Challenges and Future Directions

  • Host specificity: NdvA’s interaction with host cells varies between Brucella biovars, necessitating biovar-specific studies .

  • Structural studies: Cryo-EM or X-ray crystallography of recombinant NdvA could elucidate glucan-binding mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndvA; BR0998; BS1330_I0994; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
ndvA
Target Protein Sequence
MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTFEFPNSGQGIYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKVKQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. Its transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bms:BR0998

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein and what is its primary function in Brucella suis biovar 1?

The NdvA protein in Brucella suis biovar 1 is an ATP-binding/permease protein involved in the export of Beta-(1-->2)glucan. Based on homology studies, NdvA belongs to a family of bacterial ATP-binding transport proteins that facilitate the movement of specific substrates across cellular membranes .

The protein plays a crucial role in virulence and survival of Brucella suis, which is a zoonotic bacterial pathogen causing brucellosis, a disease affecting various animals and humans . Structurally, NdvA contains ATP-binding domains characteristic of ABC transporter family proteins, which use ATP hydrolysis to drive substrate transport.

Studies of homologous proteins in related bacteria suggest that NdvA specifically facilitates the export of cyclic extracellular polysaccharide Beta-(1-->2)glucan from the bacterial cell, which is essential for normal bacterial function and likely contributes to pathogenicity .

How does the structure of NdvA relate to its function in Beta-(1-->2)glucan export?

The NdvA protein contains a single large open reading frame encoding a polypeptide of approximately 616 amino acid residues with a molecular weight of about 67,100 daltons, based on studies of homologous proteins . The protein's structure includes:

  • ATP-binding domains: Critical for energy coupling to the transport process

  • Transmembrane domains: Form a channel or pore through which Beta-(1-->2)glucan is exported

  • Substrate recognition sites: Specifically interact with Beta-(1-->2)glucan molecules

Research on the homologous protein in Rhizobium meliloti has shown that NdvA has the greatest degree of relatedness to Escherichia coli HlyB (a protein involved in hemolysin export) and the mdr gene product of mammalian cells, which is also thought to be involved in export functions . This structural homology supports the proposed role of NdvA in Brucella suis as an export protein rather than being directly involved in Beta-(1-->2)glucan synthesis.

What are the recommended experimental approaches for studying NdvA function in Brucella suis?

For comprehensive investigation of NdvA function in Brucella suis, researchers should consider a multi-faceted experimental approach:

  • Genetic manipulation techniques:

    • Gene knockout/deletion studies to create ndvA mutants

    • Complementation assays to confirm phenotype specificity

    • Site-directed mutagenesis targeting ATP-binding domains

  • Biochemical assays:

    • ATP binding and hydrolysis measurements

    • Membrane protein extraction and reconstitution

    • Beta-(1-->2)glucan quantification (both intracellular and extracellular)

  • Structural studies:

    • Protein purification and crystallization attempts

    • Computational modeling based on homologous proteins

    • Cryo-electron microscopy for membrane protein visualization

  • In vivo functional assays:

    • Bacterial growth under various stress conditions

    • Virulence assessment in cellular and animal models

    • Biofilm formation capacity

For statistical analysis, researchers should implement advanced DOE techniques such as factorial designs or response surface methodology to efficiently explore multiple experimental factors simultaneously . Sequential experimental designs are particularly valuable, as they allow for an iterative approach where initial results inform subsequent experiments .

How can researchers optimize expression and purification of recombinant NdvA for structural and functional studies?

Optimizing expression and purification of recombinant NdvA requires careful consideration of its membrane-associated nature:

Expression optimization strategy:

ParameterOptions to testConsiderations
Expression systemE. coli BL21(DE3), C41/C43, mammalian cellsC41/C43 strains designed for membrane proteins
Fusion tagsHis6, GST, MBP, SUMOMBP often improves membrane protein solubility
Induction temperature16°C, 25°C, 30°CLower temperatures reduce aggregation
Inducer concentration0.1-1.0 mM IPTGOptimize to balance yield and toxicity
Growth mediaLB, TB, autoinductionRich media often improve yields

Purification strategy:

  • Membrane isolation through differential centrifugation

  • Detergent screening (DDM, LMNG, GDN) for optimal solubilization

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography for final polishing

  • Functional verification through ATP binding/hydrolysis assays

Critical success factors include maintaining protein stability throughout purification, selecting detergents that preserve protein structure and function, and verifying that the purified protein retains its ATP-binding capabilities .

What experimental controls are essential when studying NdvA-dependent Beta-(1-->2)glucan export?

When investigating NdvA-dependent Beta-(1-->2)glucan export, the following controls are critical for robust experimental design:

Genetic controls:

  • Wild-type Brucella suis (positive control)

  • ndvA deletion mutant (negative control)

  • Complemented ndvA mutant (restoration control)

  • Point mutants affecting ATP-binding but not protein expression (mechanistic control)

Biochemical controls:

  • ATP depletion conditions to confirm ATP-dependence

  • Non-hydrolyzable ATP analogs to distinguish binding from hydrolysis

  • Membrane permeabilization controls to differentiate export from synthesis defects

  • Known inhibitors of ABC transporters as reference compounds

Analytical controls:

  • Standard curves for Beta-(1-->2)glucan quantification

  • Time-course measurements to capture export kinetics

  • Parallel monitoring of both intracellular and extracellular Beta-(1-->2)glucan

  • Inter-strain comparison with related Brucella species

The experimental design should follow advanced statistical approaches such as Plackett-Burman Design for initial screening or Sequential Experimental Designs for progressive refinement . These methodologies enable efficient identification of significant factors affecting NdvA function while minimizing the number of experiments required.

How does Brucella suis NdvA compare to homologous proteins in other bacterial species?

Comparative analysis reveals significant homology between Brucella suis NdvA and several other bacterial transport proteins:

ProteinOrganismFunctionHomology featuresExperimental evidence
NdvARhizobium melilotiBeta-(1-->2)glucan exportHigh sequence similarity, identical functionGenetic complementation, functional studies
ChvAAgrobacterium tumefaciensBeta-(1-->2)glucan exportFunctional homolog, can substitute for each otherCross-species complementation
HlyBEscherichia coliHemolysin exportGreatest degree of relatedness in sequenceSequence alignment, structural prediction
MDR proteinsMammalian cellsDrug exportShared ATP-binding domainsSequence homology in functional domains

This homology pattern suggests that NdvA belongs to a conserved family of ATP-binding export proteins that have evolved specialized functions while maintaining core structural and mechanistic features. The ability of these proteins to substitute for one another in certain contexts highlights their fundamental similarity despite adaptation to different substrates and bacterial lifestyles .

What evolutionary insights can be gained from studying NdvA across Brucella species and biovars?

Evolutionary analysis of NdvA across Brucella species and biovars offers several important insights:

  • Conservation level: The high conservation of NdvA across Brucella species (particularly compared to B. abortus ) suggests strong selective pressure to maintain this export function, indicating its essential role in bacterial fitness.

  • Biovar-specific adaptations: Subtle sequence variations between biovars may reflect adaptations to different host environments. Brucella suis biovar 1 predominantly affects domesticated and feral pigs , and its NdvA may have specific adaptations for survival in these hosts.

  • Horizontal transfer evidence: The functional similarity to proteins in distantly related bacteria like Rhizobium and Agrobacterium suggests ancient horizontal gene transfer events or strong convergent evolution.

  • Host-pathogen co-evolution: Comparison of NdvA sequences from Brucella strains isolated from different hosts (pigs, cattle, wild animals) may reveal signatures of host adaptation in the export machinery.

  • Virulence correlation: Correlation between sequence variants and documented virulence differences between biovars could identify key residues contributing to pathogenicity.

This evolutionary perspective provides a framework for understanding how NdvA contributes to the specialized lifestyle of Brucella suis biovar 1 as a zoonotic pathogen capable of causing severe disease in both animals and humans .

How does NdvA contribute to Brucella suis virulence and host-pathogen interactions?

NdvA likely plays a critical role in Brucella suis virulence through several mechanisms:

  • Maintenance of cell envelope integrity: The export of Beta-(1-->2)glucan contributes to proper cell envelope structure, which is crucial for survival within host cells. Studies in related bacteria show that mutants lacking functional NdvA exhibit altered membrane properties .

  • Evasion of host immune responses: Beta-(1-->2)glucan may help shield bacterial surface antigens from recognition by host immune factors. In Rhizobium, NdvA mutants show altered interactions with plant hosts, suggesting a parallel role in Brucella-mammalian host interactions .

  • Adaptation to intracellular environment: Brucella suis, as an intracellular pathogen, must adapt to the challenging environment within host cells. Beta-(1-->2)glucan export likely contributes to osmotic regulation and stress resistance.

  • Biofilm formation: Beta-(1-->2)glucan may participate in biofilm development, which enhances bacterial persistence in host tissues. This is particularly relevant for chronic brucellosis infections .

Research investigating these mechanisms should utilize advanced experimental designs like Sequential Experimental Designs to systematically evaluate the contribution of NdvA to each aspect of virulence, particularly under conditions that mimic the host environment.

What are the effects of specific mutations in the ATP-binding domains of NdvA on Beta-(1-->2)glucan export?

Mutations in the ATP-binding domains of NdvA can have various effects on Beta-(1-->2)glucan export depending on the specific residues affected:

Domain/Residue typeExpected mutation effectDetection methodFunctional implications
Walker A motifAbolished ATP bindingATP binding assays, export quantificationComplete loss of export function
Walker B motifImpaired ATP hydrolysisATPase activity assaysSubstrate binding without translocation
Signature sequenceReduced coupling efficiencyRatio of ATP hydrolysis to exportEnergy wastage, reduced export
Q-loop regionAltered substrate specificityDifferential export of varied substratesPotential export of alternate molecules
Switch regionsConformational transition defectsStructural studies, kinetic analysisSlower export rates, incomplete cycles

Research in Rhizobium meliloti has demonstrated that ndvA mutants retain the ability to synthesize the protein-sugar intermediate (235,000-dalton membrane intermediate) involved in Beta-(1-->2)glucan production but fail to export the final product . This suggests that distinct mutations could separate the ATP-binding, hydrolysis, and substrate translocation functions of NdvA, providing valuable insights into its mechanism of action.

How can NdvA be targeted for development of novel antimicrobial strategies against Brucella suis?

NdvA represents a promising target for novel antimicrobial development against Brucella suis for several reasons:

  • Essential function: Its critical role in Beta-(1-->2)glucan export likely makes it essential for bacterial virulence and survival in host environments.

  • Surface accessibility: As a membrane protein, certain domains may be accessible to external compounds without requiring cellular penetration.

  • Unique features: Despite homology to mammalian proteins, bacterial-specific structural features could be exploited for selective targeting.

Potential targeting strategies include:

Small molecule inhibitors:

  • ATP-competitive inhibitors binding to the nucleotide-binding domain

  • Allosteric inhibitors disrupting conformational changes

  • Substrate-mimetic compounds blocking the transport channel

Peptide-based approaches:

  • Designed peptides targeting extracellular loops

  • Transmembrane domain-disrupting peptides

  • Intracellular domain-binding inhibitory peptides

Combination therapies:

  • NdvA inhibitors combined with conventional antibiotics

  • Dual targeting of multiple export systems

  • Host-directed therapies enhancing immune recognition of Brucella

Development of these approaches should employ advanced statistical techniques such as Response Surface Methodology to optimize inhibitor properties and performance across multiple parameters simultaneously.

What are the major challenges in working with recombinant NdvA and how can they be overcome?

Researchers working with recombinant NdvA face several significant challenges:

Challenge 1: Low expression yields

  • Solution: Optimize codon usage for expression host, use strong inducible promoters with fine-tuned expression levels, and consider fusion partners like MBP that enhance solubility and expression.

  • Implementation: Test expression in specialized E. coli strains (C41/C43) designed for membrane proteins using a range of induction temperatures (16-30°C).

Challenge 2: Protein misfolding and aggregation

  • Solution: Express protein at lower temperatures, include stabilizing agents (glycerol, specific lipids), and optimize detergent selection for membrane extraction.

  • Implementation: Screen multiple detergents using a systematic approach with stability assays to identify conditions that maintain native protein conformation.

Challenge 3: Functional assessment difficulties

  • Solution: Develop robust in vitro reconstitution systems and sensitive assays for both ATP hydrolysis and Beta-(1-->2)glucan transport.

  • Implementation: Establish proteoliposome-based transport assays with fluorescently labeled substrates for real-time monitoring of export activity.

Challenge 4: Structural characterization barriers

These methodological solutions should be implemented using advanced experimental design approaches such as Plackett-Burman Design for initial screening and Sequential Experimental Designs for optimization , maximizing information yield while minimizing resource expenditure.

What statistical analysis approaches are most appropriate for complex datasets from NdvA functional studies?

Complex datasets from NdvA functional studies require sophisticated statistical approaches:

1. Factorial Designs for multivariable analysis:

  • Application: Simultaneously evaluate effects of temperature, pH, ATP concentration, and substrate availability on NdvA function

  • Advantage: Reveals interaction effects between variables that might be missed in single-factor experiments

  • Implementation: 2^k factorial designs where k represents the number of factors being studied

2. Response Surface Methodology for optimization:

  • Application: Determine optimal conditions for NdvA activity or recombinant expression

  • Advantage: Identifies non-linear relationships and creates predictive models

  • Implementation: Central composite designs followed by second-order polynomial model fitting

3. Sequential Experimental Designs for adaptive research:

  • Application: Progressive refinement of understanding of NdvA mechanism

  • Advantage: Each experiment builds on previous findings, increasing efficiency

  • Implementation: Begin with screening experiments, followed by detailed investigation of significant factors

4. Multivariate analysis for complex relationships:

  • Application: Correlate structural features with functional outcomes

  • Advantage: Handles high-dimensional data from multiple assays

  • Implementation: Principal component analysis, partial least squares regression

These advanced statistical approaches enable researchers to extract maximum information from complex experimental data, identify subtle effects that might be overlooked in simpler analyses, and design more efficient experiments for characterizing NdvA function .

How can researchers distinguish between defects in Beta-(1-->2)glucan synthesis versus export when studying NdvA?

Distinguishing between synthesis and export defects is crucial for accurate characterization of NdvA function:

Experimental approach matrix:

Assay typeSynthesis defect indicatorsExport defect indicatorsControls needed
Cellular fractionationReduced/absent protein-sugar intermediate in membranesAccumulated intermediate in membranes, reduced extracellular glucanWild-type, known synthesis mutant
Pulse-chase experimentsReduced incorporation of labeled precursorsNormal initial incorporation but impaired releaseTime-course measurements
Complementation testsNot rescued by NdvA expressionRescued by NdvA expressionVector-only control
In vitro reconstitutionImpaired glucan synthesis activityNormal synthesis but impaired transport across membranesPurified components
Microscopy techniquesAltered localization of synthesis machineryNormal machinery localization but accumulated productImmunolabeling of both machinery and product

Research on the homologous NdvA protein in Rhizobium meliloti established that ndvA mutants retained an active 235,000-dalton membrane intermediate for Beta-(1-->2)glucan synthesis but failed to produce extracellular Beta-(1-->2)glucan . This key observation demonstrates that NdvA specifically functions in export rather than synthesis.

To implement this distinction experimentally, researchers should use Plackett-Burman Designs for initial screening of potential factors affecting either process, followed by more focused factorial designs to investigate specific mechanisms . This systematic approach ensures accurate attribution of observed phenotypes to the correct step in the Beta-(1-->2)glucan production pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.