Recombinant Brucella suis biovar 1 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks. We will then prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
plsY; BRA0601; BS1330_II0596; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
plsY
Target Protein Sequence
MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGATNVLRTGNKKL AAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWAGALVFAAAWIVTALLTRYSSLSALVASLVVPIALYSRGNQALAALFAIMTVIVFI KHRANIRRLLNGTESKIGAKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: bms:BRA0601

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Brucella suis?

Glycerol-3-phosphate acyltransferase (plsY) in Brucella suis biovar 1 is an essential enzyme involved in bacterial phospholipid biosynthesis. It catalyzes the acylation of glycerol-3-phosphate, which is a critical first step in membrane phospholipid formation. The enzyme is also known by several alternative names including Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, and G3P acyltransferase (GPAT), with the EC designation 2.3.1.n3 . The protein is encoded by the plsY gene, which is identified by the ordered locus names BRA0601 and BS1330_II0596 in the B. suis genome . Given that membrane integrity is essential for bacterial survival and virulence, plsY represents a potentially important target for understanding Brucella pathogenesis.

How does B. suis plsY compare to similar enzymes in other bacterial species?

B. suis plsY shares significant homology with glycerol-3-phosphate acyltransferases from other alpha-proteobacteria, particularly within the family Brucellaceae. While the core catalytic domains remain conserved across bacterial species, the enzyme shows specific adaptations that may reflect the unique membrane composition requirements of Brucella. The transmembrane topology and functional domains are generally conserved, though certain amino acid substitutions may contribute to substrate specificity differences between species.

The evolutionary relationship between Brucella and plant-associated bacteria is reflected in certain conserved metabolic pathways. Genomic analysis indicates that Brucella chromosomes likely have distinct evolutionary origins, with chromosome I resembling a classic bacterial circular chromosome . This evolutionary context is important for understanding the functional adaptations of enzymes like plsY within the Brucella genus.

What role might plsY play in Brucella suis virulence and host-pathogen interactions?

As a key enzyme in phospholipid biosynthesis, plsY likely contributes significantly to B. suis virulence through multiple mechanisms. Phospholipid composition directly affects membrane fluidity and permeability, which in turn influences the bacterium's ability to survive within host cells. The intracellular lifestyle of Brucella requires adaptation to various host cell compartments, and membrane remodeling facilitated by enzymes like plsY may be crucial for this process.

Recent research on Brucella metabolism suggests that within host cells, brucellae primarily utilize 3 and 4 carbon substrates fed into anaplerotic pathways rather than relying heavily on hexose/pentose catabolism . This metabolic adaptation may influence membrane lipid composition during infection, potentially altering the substrates available to plsY. The enzyme's activity under various nutrient conditions typical of the intracellular environment could therefore represent an important adaptation mechanism during infection.

Evidence from studies with other Brucella metabolic mutants indicates that disruption of specific pathways can affect virulence. For example, a triple Edd-PpdK-Pyk mutant of B. suis biovar 5 (affecting glucose metabolism pathways) was not attenuated in mice, suggesting that hexose/pentose catabolism to pyruvate is not essential for multiplication within host cells . Similar studies targeting plsY could help elucidate its specific contribution to virulence.

How does the expression and activity of plsY vary under different growth conditions and stress responses relevant to Brucella infection?

The expression and activity of plsY in B. suis likely varies significantly under different environmental conditions encountered during infection. During the transition from extracellular to intracellular environments, Brucella faces various stresses including pH changes, nutrient limitation, and oxidative stress. These conditions may trigger regulatory mechanisms that alter plsY expression or modulate its activity.

Research methodologies to investigate this question would include:

  • Quantitative RT-PCR analysis of plsY expression under various in vitro conditions mimicking different stages of infection.

  • Reporter gene constructs to monitor plsY promoter activity in real-time during cellular infection.

  • Metabolic labeling experiments to measure phospholipid synthesis rates under stress conditions.

  • Proteomic analysis to detect post-translational modifications of plsY that might regulate its activity.

The findings from such studies would need to be correlated with changes in membrane lipid composition using lipidomics approaches. This integrated analysis would provide insights into how B. suis adapts its membrane structure during infection, with important implications for survival within host cells.

What are the implications of Brucella suis biovar differences on plsY function and potential as a therapeutic target?

Brucella suis comprises five recognized biovars, each with distinct host preferences and geographical distribution patterns. Biovar 1 primarily affects domesticated swine but has also been found in feral pigs and wildlife . The functional differences in plsY across these biovars remain largely unexplored but could have significant implications for biovar-specific adaptations to different hosts.

BiovarPrimary HostsGeographical DistributionKnown Variations in Metabolism
1Domesticated pigs, feral pigsWorldwide, including AsiaClassical metabolic profile
2Wild boar, European haresEuropeMay have altered metabolism
3Domesticated pigsSoutheastern AsiaHas a single 3.3-Mb chromosome
4Caribou, reindeerArctic regionsAdapted to different host physiology
5Wild rodentsLimited reportsMetabolic adaptations unknown

The genomic differences between biovars, such as biovar 3 having a single chromosome while others have two chromosomes of smaller size , suggest potential variations in genetic regulation that could affect plsY expression or function. Understanding these differences is crucial when considering plsY as a potential therapeutic target, as biovar-specific variations could influence drug efficacy across different strains.

What are the optimal conditions for expressing and purifying recombinant B. suis plsY for structural and functional studies?

Expression and purification of recombinant B. suis plsY requires careful optimization due to its transmembrane nature. Based on protocols for similar membrane proteins, the following methodological approach is recommended:

  • Expression system selection: E. coli expression systems using vectors with strong, inducible promoters (pET or pBAD series) are commonly used. For membrane proteins like plsY, E. coli C41(DE3) or C43(DE3) strains often yield better results than standard BL21(DE3) .

  • Optimization of induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) during the induction phase typically improve the yield of properly folded membrane proteins.

  • Extraction and solubilization: Membrane fractionation followed by careful selection of detergents is critical. A screening approach using detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG) should be performed to identify optimal solubilization conditions.

  • Purification strategy: A two-step purification approach is recommended:

    • Initial purification using affinity chromatography (typically His-tag based)

    • Secondary purification via size exclusion chromatography

  • Storage conditions: Based on information for similar recombinant proteins, storage at -20°C in a Tris-based buffer with 50% glycerol is recommended . For extended storage, -80°C is preferable. Working aliquots should be stored at 4°C for no more than one week, and repeated freeze-thaw cycles should be avoided .

The introduction of stabilizing mutations or fusion partners (such as MBP or SUMO) may improve expression and stability in challenging cases.

What assay methods are available for measuring plsY enzymatic activity and how can they be optimized for inhibitor screening?

Several complementary methods can be employed to measure plsY enzymatic activity:

  • Radiometric assays: Using radiolabeled substrates (such as [14C]glycerol-3-phosphate) to measure the formation of radiolabeled lysophosphatidic acid. This high-sensitivity approach is especially valuable for kinetic studies.

  • Spectrophotometric coupled assays: These indirect methods couple acyltransferase activity to other enzymatic reactions that produce measurable changes in absorbance. For example, the release of CoA can be measured using DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)).

  • HPLC-based assays: Separation and quantification of reaction products using HPLC provides a more direct measurement of enzyme activity.

  • Mass spectrometry: LC-MS/MS methods enable precise identification and quantification of reaction products, particularly useful for complex substrate specificity studies.

For inhibitor screening, a high-throughput adaptation of these methods is necessary. The spectrophotometric approach is most readily adapted to microplate formats, though it may lack sensitivity for detecting weak inhibitors. A tiered screening approach is recommended:

  • Initial screening at fixed inhibitor concentrations using a higher-throughput method

  • IC50 determination for promising candidates

  • Mechanism of inhibition studies using more precise but lower-throughput radiometric assays

  • Confirmation of direct binding using biophysical methods (thermal shift assays, isothermal titration calorimetry)

These assays should be performed under physiologically relevant conditions, considering the pH and ion concentrations that B. suis encounters during infection.

What cell culture and animal models are most appropriate for studying the role of plsY in Brucella pathogenesis?

Selecting appropriate experimental models is crucial for studying plsY's role in B. suis pathogenesis:

  • Cell culture models:

    • Macrophage cell lines (J774A.1, RAW264.7) represent primary targets during infection

    • Primary porcine macrophages offer greater physiological relevance for B. suis studies

    • Trophoblast cells model placental infection in reproductive brucellosis

    • Protocols should include gentamicin protection assays to distinguish intracellular from extracellular bacteria

  • Animal models:

    • Mice are commonly used despite not being natural hosts for B. suis

    • The BALB/c mouse strain is particularly susceptible to Brucella infection

    • Natural host models (pigs) provide the most relevant system but present logistical challenges

    • For biovar 4 studies, reindeer or caribou would be appropriate models

The table below summarizes the advantages and limitations of different animal models:

ModelAdvantagesLimitationsTypical Applications
BALB/c miceWell-characterized, economical, multiple genetic tools availableNot natural hosts, different disease progressionInitial screening, immune response studies
Guinea pigsMore susceptible than miceLimited reagents availableConfirmatory studies
PigsNatural hosts for B. suis biovar 1Expensive, limited facilities, ethical considerationsValidation of findings, vaccine studies
ReindeerNatural hosts for biovar 4Very specialized facilities requiredBiovar 4 specific studies

When using animal models, carefully controlled experiments with appropriate sample sizes should be designed based on statistical power calculations. Typically, groups of 5-10 animals per experimental condition are used, with measurements of bacterial burden in spleen, liver, and other relevant tissues at various time points post-infection.

How can structural biology approaches contribute to understanding plsY function and developing potential inhibitors?

Structural biology offers powerful tools for understanding plsY function and guiding inhibitor development:

  • X-ray crystallography: Determining the crystal structure of B. suis plsY would provide atomic-level details of the active site and substrate binding pockets. The challenges include:

    • Obtaining sufficient quantities of pure, homogeneous protein

    • Crystallizing a membrane protein (may require lipidic cubic phase methods)

    • Potentially co-crystallizing with substrates or inhibitors

  • Cryo-electron microscopy (cryo-EM): This emerging technique offers advantages for membrane proteins that are difficult to crystallize. Recent advances in resolution make it increasingly viable for proteins of plsY's size (~22 kDa).

  • NMR spectroscopy: While challenging for full-structure determination of membrane proteins, NMR can provide valuable information about:

    • Dynamic regions of the protein

    • Ligand binding sites through chemical shift perturbation experiments

    • Conformational changes upon substrate binding

  • Computational approaches:

    • Homology modeling based on related acyltransferases

    • Molecular dynamics simulations to understand conformational flexibility

    • Virtual screening for potential inhibitors using the structural model

The methodological workflow for structure-based inhibitor development typically involves:

  • Structure determination or high-quality model generation

  • Identification of druggable pockets using computational algorithms

  • Virtual screening of compound libraries against these pockets

  • Experimental validation of top hits using activity assays

  • Structure-activity relationship studies to optimize lead compounds

  • Co-crystallization attempts with optimized inhibitors

These structural approaches should be integrated with functional data from mutagenesis studies to provide a comprehensive understanding of plsY's catalytic mechanism.

What are the key considerations for analyzing and comparing plsY expression data across different Brucella strains and experimental conditions?

When analyzing plsY expression data, researchers should consider several methodological and analytical factors:

  • Normalization strategies:

    • For qRT-PCR, carefully selected reference genes that maintain stable expression under experimental conditions should be used

    • Multiple reference genes (minimum of 3) should be validated and used for normalization

    • Common Brucella reference genes include 16S rRNA, rpoB, and gyrA

  • Statistical analysis:

    • Appropriate statistical tests based on data distribution (parametric vs. non-parametric)

    • Multiple testing correction when comparing across numerous conditions

    • Minimum of 3-4 biological replicates per condition

    • Power analysis to determine adequate sample size

  • Comparative analysis across strains:

    • Account for potential differences in PCR efficiency due to sequence variations

    • Consider analyzing relative rather than absolute expression levels

    • When comparing biovar 1 (with two chromosomes) to biovar 3 (with a single chromosome) , genomic context may influence expression patterns

  • Integration with other data types:

    • Correlation with proteomic data to assess post-transcriptional regulation

    • Functional assays to determine if expression changes translate to altered enzymatic activity

    • Metabolomic analysis to assess downstream effects on phospholipid composition

A comprehensive experimental design for expression analysis should include:

  • Time course measurements to capture dynamic responses

  • Dose-response relationships for relevant environmental stimuli

  • Appropriate controls for each experimental variable

  • Validation using complementary techniques (e.g., both qRT-PCR and RNA-seq)

How should researchers interpret structural and functional differences between plsY and other acyltransferases when designing inhibitors?

When interpreting structural and functional comparisons between plsY and other acyltransferases for inhibitor design, researchers should focus on several key considerations:

  • Sequence conservation analysis:

    • Identify strictly conserved residues likely involved in catalysis

    • Distinguish between conservation across all acyltransferases versus Brucella-specific conservation

    • Pay special attention to residues unique to pathogenic species

  • Structural homology interpretation:

    • Analyze binding pocket architecture for species-specific features

    • Evaluate differences in protein dynamics that might affect inhibitor binding

    • Consider allosteric sites that might be more divergent than active sites

  • Substrate specificity determinants:

    • Compare acyl chain length preferences across different species

    • Identify structural elements controlling specificity

    • Use this information to design inhibitors with improved selectivity

  • Host enzyme considerations:

    • Compare with mammalian glycerol-3-phosphate acyltransferases to avoid off-target effects

    • Focus inhibitor design on bacterial-specific structural features

    • Perform counter-screening against host enzymes during lead optimization

A methodical approach to translating these comparisons into inhibitor design would include:

  • Structure-based virtual screening targeting unique features of B. suis plsY

  • Fragment-based approaches focusing on highly conserved catalytic residues

  • Development of selectivity models based on structural differences between bacterial and host enzymes

  • Iterative optimization guided by structure-activity relationship studies

What challenges might researchers face when translating in vitro findings about plsY to in vivo infection models, and how can these be addressed?

Translating in vitro findings about plsY to in vivo infection models presents several methodological challenges:

  • Physiological relevance of in vitro conditions:

    • In vitro assays typically use simplified conditions that may not reflect the intracellular environment

    • Solution: Develop more complex in vitro systems that better mimic intracellular conditions, including pH, nutrient availability, and host factors

  • Temporal dynamics of expression and activity:

    • Expression and activity may vary throughout different stages of infection

    • Solution: Use time-course experiments in both in vitro and in vivo models, with sampling at multiple infection stages

  • Tissue-specific effects:

    • B. suis may behave differently in various tissues, potentially due to different metabolic environments

    • Solution: Compare bacterial populations isolated from different tissues using techniques like laser capture microdissection combined with transcriptomics

  • Compensatory mechanisms in vivo:

    • Metabolic plasticity of Brucella may lead to adaptation to plsY inhibition in vivo

    • Solution: Conduct studies with conditional mutants or carefully titrated inhibitor concentrations to detect compensatory pathways

  • Host factors influencing membrane lipid requirements:

    • Host-derived lipids might supplement bacterial requirements in vivo

    • Solution: Combine lipidomics with stable isotope labeling to track lipid origins during infection

A comprehensive approach to addressing these challenges would include:

  • Development of ex vivo systems using primary cells from natural hosts

  • Validation of key findings across multiple model systems

  • Integration of multi-omics data (transcriptomics, proteomics, metabolomics) from both in vitro and in vivo experiments

  • Advanced imaging techniques to visualize plsY localization and activity during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.