Recombinant Brucella suis biovar 1 Immunogenic membrane protein YajC (yajC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
yajC; BR0890; BS1330_I0886; Sec translocon accessory complex subunit YajC; Immunogenic membrane protein YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
yajC
Target Protein Sequence
MFVTPAFAQASGSVVGPDMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDT VVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPVADNKNK
Uniprot No.

Target Background

Function

The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, membrane protein insertion, and the assembly of membrane protein complexes. While the SecYEG complex plays a crucial role in the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these processes.

Database Links

KEGG: bms:BR0890

Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and cellular localization of YajC protein in Brucella species?

YajC is a conserved membrane protein found in many bacterial species including Brucella. The protein is characterized by an N-terminal transmembrane domain and a cytosolic C-terminus. Structural analysis indicates that YajC is part of the core genome of both Gram-positive and Gram-negative bacteria . In Brucella species, YajC functions as part of membrane protein insertion pathways.

The protein's localization is primarily in the bacterial cell membrane where it interacts with other components of the protein secretion and insertion machinery. YajC is predicted to form an integral membrane component of a larger complex that includes SecD and SecF proteins in association with the SecYEG complex . This positioning allows YajC to participate in protein translocation processes across the bacterial membrane, which is essential for various cellular functions including biofilm formation and pathogenesis.

How is YajC involved in membrane protein insertion pathways?

YajC plays a critical role in at least two distinct cotranslational membrane protein insertion pathways in bacteria. These pathways include:

  • The signal recognition particle (SRP)-SecYEG-YajC-YidC1 pathway

  • The SRP-YajC-YidC2 pathway

These pathways are essential for the proper insertion of various proteins into the bacterial membrane. In Streptococcus mutans, YajC has been identified as part of these two pathways, though its exact function remains to be fully elucidated . YajC is believed to be involved in either:

  • Stabilizing the SRP-SecYEG-YajC-YidC1 and SRP-YajC-YidC2 protein complexes

  • Retaining proteins for proper docking to the YidC insertases for translocation across the membrane

Studies in Enterococcus faecium have provided evidence that YajC contributes to the retention of proteins at the cell surface, as deletion of the yajC gene results in increased release of proteins into the culture supernatant . This suggests that YajC may function as a stabilizing component that helps maintain the integrity of the membrane protein insertion machinery.

What homologous YajC proteins exist across bacterial species and what is known about their conservation?

YajC is highly conserved across diverse bacterial species, being part of the core genome of both Gram-positive and Gram-negative bacteria. Significant homologs have been identified and studied in:

  • Escherichia coli, where YajC was first described as part of an integral membrane heterotrimeric complex with SecD and SecF, forming the SecYEGDF-YajC holotranslocon

  • Streptococcus mutans, where YajC associates with protein insertion pathways

  • Enterococcus faecium, where YajC contributes to biofilm formation

  • Brucella species, including B. abortus and likely B. suis

Sequence analysis reveals that the yajC gene is consistently located in proximity to secD genes in many bacterial genomes, suggesting a functional relationship that has been maintained throughout bacterial evolution . The conservation of YajC across diverse bacterial species underscores its fundamental importance in bacterial physiology and membrane protein dynamics.

How does recombinant YajC protein stimulate specific immune responses in animal models?

Recombinant YajC protein has demonstrated significant immunogenic properties in mouse models. When expressed as a fusion protein with maltose binding protein (MBP) in Escherichia coli, recombinant YajC stimulates both humoral and cell-mediated immune responses in mice vaccinated with B. abortus RB51 .

The immunological responses to YajC include:

  • Production of specific antibodies: Mice vaccinated with live B. abortus strains (RB51, 19, 2308) and B. melitensis RM1 produce antibodies that recognize YajC in Western blot analyses . Interestingly, sera from mice immunized with killed B. abortus strains do not react with recombinant YajC protein, suggesting that the immunogenicity may depend on active bacterial processes during infection .

  • Cell-mediated immune responses: Splenocytes from mice vaccinated with B. abortus RB51 proliferate when stimulated in vitro with recombinant MBP-YajC fusion protein . This proliferative response is typically observed in 3-day cultures but diminishes in 5-day cultures, indicating a specific temporal pattern to the cellular response.

  • Cytokine production: In response to YajC stimulation, splenocytes from vaccinated mice produce gamma interferon (IFN-γ) but not interleukin-4 (IL-4) . This cytokine profile is characteristic of a Th1-type immune response, which is considered protective against intracellular pathogens like Brucella.

These findings collectively demonstrate that YajC is capable of stimulating both arms of the adaptive immune system, with a bias toward protective Th1-type responses that are crucial for controlling intracellular bacterial infections.

What cytokine profiles are observed in response to YajC stimulation, and what do they indicate about the immune response?

Stimulation with recombinant YajC protein elicits a distinctive cytokine profile that provides valuable insights into the nature of the immune response. The following table summarizes the IFN-γ production by splenocytes from vaccinated and naive mice in response to various stimulants:

StimulantConcentration of IFN-γ (ng/ml)
3-day cultures5-day cultures
Vaccinated miceNaive miceVaccinated miceNaive mice
Media
ConA30.55 ± 0.65*28.31 ± 2.00*27.96 ± 0.43*26.05 ± 0.89*
RB5129.63 ± 1.00*29.12 ± 0.30*
MBP-YajC0.42 ± 0.10**2.90 ± 0.89**
MBP

*Significant IFN-γ production
**Moderate but significant IFN-γ production
— No detectable IFN-γ production

The cytokine profile observed shows several important features:

  • YajC specifically induces IFN-γ production in splenocytes from vaccinated mice but not from naive mice, indicating an antigen-specific response .

  • The IFN-γ production increases from 3-day to 5-day cultures (0.42 ± 0.10 to 2.90 ± 0.89 ng/ml), suggesting a developing response over time .

  • The absence of IL-4 production (not shown in the table but mentioned in the research) in conjunction with IFN-γ production indicates a Th1-polarized immune response .

This Th1-dominant cytokine profile is particularly significant because protection against intracellular pathogens like Brucella typically requires cell-mediated immunity characterized by IFN-γ production. IFN-γ activates macrophages to more effectively kill intracellular bacteria and promotes the development of further Th1 responses. The ability of YajC to stimulate this protective cytokine profile makes it a promising candidate for inclusion in subunit vaccines against brucellosis.

How does YajC contribute to biofilm formation in bacteria, and what are the implications for pathogenesis?

YajC plays a crucial role in biofilm formation, particularly in Enterococcus faecium where it has been extensively studied. Deletion of the yajC gene in E. faecium strain E1162 results in:

  • Significantly impaired biofilm formation in vitro

  • Attenuation in a rat endocarditis model, demonstrating reduced virulence in vivo

The mechanisms through which YajC contributes to biofilm formation appear to involve:

  • Protein retention at the cell surface: Mass spectrometry analysis of supernatants from washed ΔyajC cells revealed increased amounts of cytoplasmic and cell-surface-located proteins compared to wild-type cells. This suggests that proteins on the surface of the yajC mutant are only loosely attached .

  • Stabilization of membrane protein insertion pathways: YajC likely contributes to the proper functioning of the SRP-SecYEG-YajC-YidC1 and SRP-YajC-YidC2 pathways, which are essential for the insertion of membrane proteins. Disruption of these pathways may affect the proper localization of adhesins and other surface proteins required for biofilm formation .

  • Retention of biofilm-associated proteins: Proteome analysis of supernatants from ΔyajC mutants revealed several proteins important in adherence to host cells and biofilm formation, including the tip protein of PilB (also designated endocarditis and biofilm associated protein, EbpA) and the major subunit of PilA .

The implications for pathogenesis are significant:

  • Biofilm formation is considered an important step in the pathogenesis of catheter or other foreign body-related infections .

  • The reduction in biofilm formation observed in yajC mutants corresponds with reduced virulence in animal models, suggesting that YajC could be a potential target for anti-biofilm and anti-virulence strategies .

  • The conserved nature of YajC across bacterial species suggests that targeting this protein could potentially affect biofilm formation in multiple pathogens, making it an attractive target for broad-spectrum anti-biofilm approaches.

These findings establish YajC as an important contributor to bacterial pathogenesis through its role in biofilm formation and suggest that it could be exploited as a target for novel therapeutic approaches.

What are the optimal methods for expressing and purifying recombinant YajC protein for immunological studies?

The successful expression and purification of recombinant YajC protein is crucial for immunological studies. Based on the available research, the following methodology has proven effective:

  • Expression System:

    • Escherichia coli has been successfully used as an expression host for recombinant YajC protein

    • Expression as a fusion protein with maltose binding protein (MBP) enhances solubility and facilitates purification

  • Expression Construct:

    • The yajC gene can be cloned into appropriate expression vectors (e.g., pMAL-c2) to create an MBP-YajC fusion construct

    • Inclusion of appropriate restriction sites facilitates cloning and subsequent purification steps

    • Verification of the construct should be performed by sequencing to ensure the correct reading frame

  • Induction Conditions:

    • IPTG (isopropyl-β-D-thiogalactopyranoside) induction is typically used with E. coli expression systems

    • Optimization of induction parameters (concentration, temperature, duration) is recommended to maximize yield while maintaining protein solubility

  • Purification Strategy:

    • Affinity chromatography using amylose resin is effective for purifying MBP-fusion proteins

    • Column elution with maltose allows for specific elution of the MBP-YajC fusion protein

    • Additional purification steps such as ion-exchange or size-exclusion chromatography may be necessary to achieve high purity

  • Quality Control:

    • SDS-PAGE analysis to confirm protein size and purity

    • Western blotting with anti-MBP or anti-YajC antibodies to verify identity

    • Mass spectrometry for precise molecular characterization

    • Endotoxin removal and testing are crucial for immunological studies to prevent non-specific immune activation

This method has successfully produced recombinant YajC protein suitable for Western blot analysis and for in vitro stimulation of splenocytes in immunological studies . The expression of YajC as an MBP fusion protein has the additional advantage of MBP serving as an internal control in immunological assays, as demonstrated in studies where MBP alone was used to control for non-specific immune responses .

How can researchers effectively measure YajC-specific immune responses in laboratory models?

Measuring YajC-specific immune responses requires a comprehensive approach that addresses both humoral and cell-mediated immunity. The following methodological approaches have proven effective:

  • Humoral Immune Response Assessment:

    • Western Blot Analysis: This technique has been successfully used to detect YajC-specific antibodies in sera from mice inoculated with various Brucella strains (RB51, 19, 2308, and B. melitensis RM1) . The method involves:

      • Transfer of purified recombinant YajC protein to nitrocellulose membranes

      • Blocking non-specific binding sites

      • Incubation with test sera (typically at 1:100 dilution)

      • Detection with species-appropriate secondary antibodies (e.g., anti-mouse IgG)

      • Development using enzyme substrates or chemiluminescence

    • ELISA: While not explicitly mentioned in the provided search results, enzyme-linked immunosorbent assays represent a quantitative approach to measuring antibody titers and could be adapted for YajC-specific responses

    • Antibody Isotyping: Determination of antibody isotypes (IgG1, IgG2a, etc.) can provide insights into the type of immune response (Th1 vs. Th2) being generated

  • Cell-Mediated Immune Response Assessment:

    • Lymphocyte Proliferation Assay: This has been successfully used to assess T-cell responses to YajC :

      • Isolation of splenocytes from immunized and control animals

      • Culture with purified recombinant YajC protein (typically 5-20 μg/ml)

      • Measurement of proliferation after 3 and 5 days of culture

      • Incorporation of positive controls (ConA, whole bacteria) and negative controls (media alone, MBP)

    • Cytokine Production Assays: Measurement of cytokines in culture supernatants using ELISA or cytometric bead arrays:

      • Key cytokines to measure include IFN-γ (Th1), IL-4 (Th2), and IL-17 (Th17)

      • Collection of supernatants at multiple time points (e.g., 3 and 5 days) to capture temporal patterns

      • Comparison with appropriate positive and negative controls

    • Flow Cytometry: While not explicitly mentioned in the search results, flow cytometric analysis can provide detailed characterization of responding T-cell populations (CD4+ vs. CD8+, memory vs. naive, etc.)

  • In Vivo Challenge Models:

    • Animal challenge models (e.g., mouse or rat models of infection) can be used to assess the protective efficacy of YajC-induced immune responses

    • Endpoints may include bacterial burden in organs, clinical scores, or survival rates

    • The rat endocarditis model has been specifically mentioned for assessing the role of YajC in biofilm formation and could potentially be adapted for immunological studies

By combining these methodological approaches, researchers can comprehensively characterize both the quantity and quality of YajC-specific immune responses, providing insights into the potential of YajC as a vaccine candidate or diagnostic target.

What animal models are most appropriate for studying YajC-induced immunity against Brucella infections?

Several animal models have been utilized to study YajC-induced immunity and its role in Brucella infections. Based on the research data, the following models are most appropriate:

  • Mouse Models:

    • BALB/c Mice: These have been successfully used to screen for B. abortus antigens that react with IgG2a antibodies, which are indicative of a Th1 response . This model is particularly useful because:

      • BALB/c mice are susceptible to Brucella infection

      • The immune response in these mice has been well-characterized

      • They allow for detailed analysis of both humoral and cell-mediated immunity

      • Splenocytes from immunized BALB/c mice have demonstrated YajC-specific proliferation and IFN-γ production

    • Vaccination-Challenge Model: Mice vaccinated with attenuated Brucella strains (e.g., RB51) and subsequently challenged with virulent strains can be used to assess protective efficacy of YajC-based immunization strategies

  • Rat Models:

    • Rat Endocarditis Model: This has been specifically used to evaluate the role of YajC in bacterial pathogenesis . While this model was used to study YajC in E. faecium, it could potentially be adapted for Brucella studies, particularly to investigate:

      • The role of YajC in biofilm formation during Brucella infection

      • The impact of YajC-specific immune responses on bacterial colonization and persistence

      • The efficacy of YajC-targeted interventions in preventing or treating infection

  • Large Animal Models:

    • While not specifically mentioned in the search results, natural hosts of Brucella such as cattle, sheep, and goats would be valuable for translational studies of YajC-induced immunity

    • These models more closely reflect the natural host-pathogen interaction and would provide more relevant data for vaccine development

  • Cell Culture Models:

    • Macrophage Infection Models: Since Brucella is an intracellular pathogen that survives within macrophages, cell culture models using mouse or human macrophages can provide valuable insights into:

      • The role of YajC in bacterial survival within macrophages

      • The impact of YajC-specific antibodies or activated T-cells on bacterial clearance

      • The mechanisms of protective immunity against Brucella

When selecting an animal model, researchers should consider several factors:

  • The specific research question being addressed

  • The need to evaluate both humoral and cell-mediated responses

  • The relevance to human or animal brucellosis

  • Ethical considerations and the principle of replacement, reduction, and refinement (3Rs) in animal experimentation

The mouse model, particularly BALB/c mice, has been the most extensively used and validated for studying YajC-induced immunity against Brucella infections based on the available research data .

How do researchers address potential contradictions in YajC function across different bacterial species?

Researchers face several contradictions and complexities when studying YajC function across different bacterial species. Addressing these contradictions requires nuanced approaches:

  • Comparative Genomics and Structural Analysis:

    • Despite YajC being part of the core genome of both Gram-positive and Gram-negative bacteria, its functional associations may vary

    • In E. coli, YajC forms part of the SecYEGDF-YajC holotranslocon

    • In S. mutans, YajC is associated with two separate pathways: SRP-SecYEG-YajC-YidC1 and SRP-YajC-YidC2

    • Researchers address these differences by detailed sequence and structural comparisons to identify conserved domains and species-specific adaptations

  • Functional Complementation Studies:

    • Testing whether YajC from one species can complement defects in another species provides insights into functional conservation

    • Cross-species complementation studies can reveal which aspects of YajC function are universal versus species-specific

    • This approach can help resolve contradictions in functional assignments across species

  • Phenotypic Analysis of Deletion Mutants:

    • Studies in E. faecium demonstrated that ΔyajC mutants have impaired biofilm formation and reduced virulence in a rat endocarditis model

    • Similar phenotypic analyses in other species, including Brucella, would help determine whether these functions are conserved

    • Comparative phenotyping across species helps address contradictions in the literature regarding YajC function

  • Context-Dependent Protein Interactions:

    • YajC interacts with different protein complexes in different bacterial species

    • Researchers use techniques such as co-immunoprecipitation, bacterial two-hybrid systems, and proteomics to map species-specific protein interaction networks

    • These approaches help explain functional contradictions by revealing differences in the molecular context in which YajC operates

  • Integration of Multiple Data Types:

    • Combining data from genomics, transcriptomics, proteomics, and structural biology provides a more complete picture of YajC function

    • Meta-analysis of data from multiple species can reveal patterns that explain apparent contradictions

    • Statistical approaches such as principal component analysis can help identify factors that contribute to functional differences across species

  • Standardized Experimental Protocols:

    • Adopting standardized protocols for functional characterization of YajC across different bacterial species

    • Controlling for variables such as growth conditions, genetic background, and experimental methods

    • This approach helps distinguish genuine functional differences from methodological artifacts

By systematically addressing these challenges, researchers can develop a more coherent understanding of YajC function that accounts for both conserved and species-specific aspects, resolving apparent contradictions in the literature.

What are the key considerations for interpreting YajC-specific antibody responses in the context of Brucella infections?

Interpreting YajC-specific antibody responses in Brucella infections requires careful consideration of several factors that influence the results and their biological significance:

  • Antibody Specificity and Cross-Reactivity:

    • YajC is conserved across bacterial species, raising the possibility of cross-reactive antibodies

    • Researchers must distinguish between antibodies specific to Brucella YajC versus those cross-reacting with YajC from other bacteria

    • Absorption with heterologous bacteria or recombinant proteins can help determine specificity

  • Timing of Antibody Response:

    • The kinetics of anti-YajC antibody development may differ from responses to other Brucella antigens

    • Serial sampling and temporal analysis are important for proper interpretation

    • The relationship between antibody appearance and disease progression needs careful evaluation

  • Antibody Isotype Profiles:

    • The search results indicate that YajC stimulates IgG responses in mice, with IgG2a being specifically studied

    • IgG2a in mice is associated with Th1-type responses, which are generally protective against intracellular pathogens

    • A comprehensive isotype analysis (IgG1, IgG2a, IgG2b, IgG3, IgA, IgM) provides insights into the type of immune response being generated

  • Live versus Killed Bacteria:

    • The search results indicate that mice immunized with live Brucella strains (RB51, 19, 2308, B. melitensis RM1) produced antibodies to YajC, while those immunized with killed bacteria did not

    • This suggests that the expression or presentation of YajC may differ between live and killed bacteria

    • This distinction is crucial for vaccine development and diagnostic test interpretation

  • Relationship Between Antibody Levels and Protection:

    • The mere presence of anti-YajC antibodies does not necessarily indicate protection

    • Correlation with other immune parameters (e.g., T-cell responses, cytokine profiles) is essential

    • Challenge studies are needed to establish the protective capacity of YajC-specific antibodies

  • Technical Considerations in Antibody Detection:

    • The method of recombinant protein production affects epitope exposure (e.g., MBP fusion may alter protein folding)

    • The detection method (Western blot, ELISA, etc.) influences sensitivity and specificity

    • Standardization against reference sera is important for quantitative comparisons

  • Host Factors:

    • Genetic background of the host affects antibody responses

    • Prior exposure to related bacteria may influence anti-YajC antibody profiles

    • Immunocompromised states can alter both the magnitude and quality of antibody responses

These considerations highlight the complexity of interpreting antibody responses to YajC and emphasize the need for comprehensive analysis that accounts for multiple variables. Researchers should avoid oversimplified interpretations and instead integrate antibody data with other immunological parameters for a more complete understanding of the host-pathogen interaction.

What technical challenges exist in studying YajC function in Brucella species?

Studying YajC function in Brucella species presents several technical challenges that researchers must overcome to obtain reliable and meaningful results:

  • Biosafety Considerations:

    • Brucella species are classified as biosafety level 3 (BSL-3) pathogens, requiring specialized containment facilities and safety protocols

    • This restricts the number of laboratories that can work directly with these organisms

    • Work with virulent Brucella strains requires additional precautions beyond standard BSL-3 practices

  • Genetic Manipulation Challenges:

    • Creation of gene knockouts or knockdowns in Brucella can be technically demanding

    • Efficiency of transformation may be low compared to model organisms

    • Selection of recombinants requires careful optimization

    • Markerless deletion systems, while available, may be less efficient than in other bacterial systems

  • Protein Expression and Purification Issues:

    • YajC is a membrane protein, which presents challenges for expression and purification

    • Expression as a fusion with MBP has been successful but may affect protein folding and function

    • Ensuring proper folding and maintenance of native structure is critical for functional studies

    • Removal of endotoxin contamination is essential for immunological studies

  • Verification of Protein Localization:

    • Confirming the membrane localization of YajC in Brucella requires specialized techniques

    • Available antibodies may have limited specificity or sensitivity

    • Subcellular fractionation of Brucella requires optimization to avoid cross-contamination

  • Functional Redundancy:

    • YajC may have functionally redundant proteins in Brucella, complicating phenotypic analysis of mutants

    • Multiple membrane protein insertion pathways may exist, as suggested by studies in other bacteria

    • Identification and characterization of these pathways requires sophisticated proteomics approaches

  • In Vivo Studies:

    • Animal models of Brucella infection have inherent variability

    • Ethical considerations limit extensive in vivo experimentation

    • Correlation between animal models and human or animal disease may be imperfect

  • Technical Limitations in Studying Protein-Protein Interactions:

    • YajC functions as part of protein complexes in the membrane

    • Studying these interactions in their native membrane environment is technically challenging

    • Available methods (e.g., bacterial two-hybrid) may not accurately reflect in vivo interactions

  • Translating Findings from Model Systems:

    • Studies in E. coli or other model organisms may not directly translate to Brucella

    • Species-specific adaptations may alter YajC function or interactions

    • Validation in Brucella is essential but technically demanding

Addressing these challenges requires a multidisciplinary approach combining molecular biology, biochemistry, immunology, and advanced imaging techniques. Collaboration between laboratories with complementary expertise and access to appropriate facilities is often necessary to overcome these technical barriers and advance our understanding of YajC function in Brucella species.

What are the promising applications of YajC in Brucella vaccine development?

YajC holds significant potential for Brucella vaccine development, with several promising avenues for future research:

  • Subunit Vaccine Development:

    • YajC could serve as a component of subunit vaccines due to its ability to stimulate both humoral and cell-mediated immune responses

    • The protein induces a Th1-biased immune response characterized by IFN-γ production, which is considered protective against intracellular pathogens like Brucella

    • Future research could focus on optimizing YajC formulation, including:

      • Combination with other immunogenic Brucella proteins

      • Selection of appropriate adjuvants to enhance immunogenicity

      • Development of delivery systems to target antigen-presenting cells

  • DNA Vaccine Approaches:

    • The yajC gene could be incorporated into DNA vaccine constructs

    • Such vaccines could provide sustained expression of YajC, potentially enhancing immune responses

    • Codon optimization for the target species (cattle, sheep, goats, humans) would be an important consideration

  • Live Vector Vaccines:

    • Attenuated bacterial or viral vectors expressing YajC could be developed

    • These might combine the advantages of live attenuated vaccines (broad immune activation) with the safety of subunit approaches

    • Vectors that specifically target mucosal surfaces might be particularly effective for Brucella vaccines

  • Epitope Mapping and Rational Design:

    • Identification of immunodominant T-cell and B-cell epitopes within YajC

    • Design of synthetic peptides or recombinant constructs containing multiple epitopes

    • This approach could potentially enhance immunogenicity while avoiding regions that might contribute to adverse reactions

  • Cross-Protection Studies:

    • Investigation of whether YajC-based vaccines provide protection against multiple Brucella species

    • The conserved nature of YajC suggests potential for broad protection

    • This would be particularly valuable in regions where multiple Brucella species are endemic

  • Mechanism of Protection Studies:

    • Detailed investigation of how YajC-specific immune responses contribute to protection

    • Understanding the relative contributions of antibodies, CD4+ T cells, and CD8+ T cells

    • Identification of correlates of protection to guide vaccine optimization

  • Translation to Target Species:

    • Evaluation of YajC immunogenicity in natural hosts of Brucella (cattle, sheep, goats)

    • Assessment of protective efficacy in these species

    • Optimization of vaccination protocols (dose, route, schedule) for different target populations

  • Combination with Immune Modulators:

    • Co-administration of YajC with cytokines or other immune modulators

    • This approach could potentially enhance the Th1 bias of the immune response

    • Controlled-release formulations could provide sustained immunomodulation

These research directions build upon the established immunogenicity of YajC and could lead to the development of effective vaccines against brucellosis, addressing an important global health challenge. The conservation of YajC across Brucella species suggests potential for broad protection, while its ability to stimulate Th1-type responses aligns with the requirements for protection against this intracellular pathogen.

How might YajC function as a potential target for antimicrobial development?

YajC presents several characteristics that make it a promising target for novel antimicrobial development strategies:

  • Essential Role in Membrane Protein Insertion:

    • YajC participates in critical membrane protein insertion pathways (SRP-SecYEG-YajC-YidC1 and SRP-YajC-YidC2)

    • Disruption of these pathways could compromise bacterial membrane integrity and function

    • Small molecules targeting these interactions could have bactericidal or bacteriostatic effects

  • Contribution to Biofilm Formation:

    • Studies in E. faecium have demonstrated that YajC plays a significant role in biofilm formation

    • Deletion of yajC results in impaired biofilm formation in vitro and attenuated virulence in a rat endocarditis model

    • Anti-biofilm agents targeting YajC could potentially:

      • Prevent biofilm formation on medical devices

      • Enhance the efficacy of conventional antibiotics against biofilm-associated infections

      • Reduce bacterial persistence in chronic infections

  • Conservation Across Bacterial Species:

    • YajC is part of the core genome of both Gram-positive and Gram-negative bacteria

    • This conservation suggests that YajC-targeted antimicrobials might have broad-spectrum activity

    • The essentiality of the pathways involving YajC may reduce the likelihood of resistance development

  • Precedent from Related Research:

    • A small molecule screen in Staphylococcus aureus identified a compound targeting YidC that reduced biofilm formation and toxin production

    • Similar approaches could be applied to identify compounds targeting YajC or YajC-containing complexes

    • Structure-based drug design could be employed to develop specific inhibitors of YajC function

  • Potential Antimicrobial Strategies:

    • Small molecule inhibitors of YajC protein-protein interactions

    • Peptide mimetics that disrupt YajC association with SecYEG or YidC

    • Antisense oligonucleotides or RNA interference approaches to reduce YajC expression

    • CRISPR-Cas-based antimicrobials targeting the yajC gene

  • Combination Therapy Approaches:

    • YajC-targeted agents could potentially sensitize bacteria to conventional antibiotics

    • Combinations might be particularly effective against biofilm-associated or persistent infections

    • This approach could potentially revitalize the use of existing antibiotics facing resistance issues

  • Diagnostic-Therapeutic Combinations:

    • YajC-specific antibodies could be used for both diagnostic purposes and therapeutic targeting

    • Immunotherapeutic approaches using anti-YajC antibodies conjugated to antimicrobial agents

    • This could provide highly specific targeted therapy

  • Challenges and Considerations:

    • Ensuring specificity for bacterial YajC without affecting host proteins

    • Achieving sufficient penetration to reach the bacterial membrane target

    • Developing formulations suitable for different infection sites

    • Addressing potential toxicity or immunogenicity concerns

The potential of YajC as an antimicrobial target is particularly promising given its involvement in essential cellular processes and its role in biofilm formation. Future research should focus on validating YajC as a druggable target in Brucella and other pathogenic bacteria and developing high-throughput screening approaches to identify potential inhibitors.

What are the unexplored aspects of YajC biology requiring further investigation?

Despite progress in understanding YajC's functions, several critical aspects of its biology remain unexplored and warrant further investigation:

  • Structural Biology of YajC Complexes:

    • The three-dimensional structure of YajC in complex with its interaction partners (SecYEG, YidC) remains largely unknown

    • Structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would provide valuable insights into the molecular mechanisms of YajC function

    • Understanding the conformational changes that occur during protein translocation would inform both basic biology and drug design efforts

  • Regulatory Mechanisms:

    • The regulation of yajC expression in response to environmental conditions and stress remains poorly understood

    • Transcriptional, translational, and post-translational regulation of YajC may vary across bacterial species

    • The impact of host environments on YajC expression and function during infection deserves exploration

  • Comprehensive Protein Interaction Network:

    • While YajC is known to interact with components of membrane protein insertion pathways, its complete interactome remains undefined

    • Systematic approaches such as bacterial two-hybrid screens, co-immunoprecipitation coupled with mass spectrometry, or proximity labeling techniques could reveal novel interaction partners

    • Species-specific differences in the YajC interaction network may explain functional variations across bacteria

  • Role in Bacterial Stress Responses:

    • The potential involvement of YajC in responses to various stresses (oxidative, pH, temperature, antibiotic) has not been thoroughly investigated

    • Such studies would provide insights into the physiological roles of YajC beyond protein translocation

    • The contribution of YajC to bacterial adaptation within host environments deserves particular attention

  • Post-Translational Modifications:

    • Whether YajC undergoes post-translational modifications that influence its function is unknown

    • Modifications such as phosphorylation or methylation could regulate YajC activity or interactions

    • Proteomics approaches would be valuable for identifying such modifications

  • YajC Homologs in Non-Bacterial Systems:

    • The potential presence and function of YajC homologs in eukaryotic systems has received little attention

    • Comparative genomics and functional studies across domains of life could reveal evolutionary insights

    • Such investigations might also inform considerations regarding the specificity of YajC-targeted therapeutics

  • Role in Horizontal Gene Transfer:

    • Whether YajC contributes to bacterial competence or DNA uptake mechanisms is unexplored

    • Potential involvement in the insertion of proteins related to DNA acquisition would have implications for bacterial evolution and antibiotic resistance spread

  • Temporal Dynamics During Infection:

    • The temporal patterns of YajC expression and activity during different stages of infection remain unexplored

    • In vivo expression studies using reporter constructs or RNA sequencing of bacteria isolated from infected hosts would provide valuable insights

    • Understanding these dynamics could inform therapeutic targeting strategies

  • Contribution to Immune Evasion:

    • Whether YajC plays a role in immune evasion strategies of intracellular pathogens like Brucella is unknown

    • Studies examining the impact of YajC on phagosome maturation, antigen presentation, or cytokine responses could reveal new aspects of host-pathogen interactions

  • Compensatory Mechanisms in YajC-Deficient Bacteria:

    • The mechanisms by which bacteria compensate for YajC deficiency are poorly understood

    • Identification of backup systems or adaptive responses could inform strategies to overcome potential resistance to YajC-targeted therapeutics

Addressing these knowledge gaps would significantly advance our understanding of YajC biology and inform both fundamental bacterial physiology research and applied efforts in vaccine and antimicrobial development. Multidisciplinary approaches combining genetics, biochemistry, structural biology, immunology, and in vivo infection models will be necessary to fully elucidate the complex biology of this conserved bacterial protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.