Recombinant Brucella suis biovar 1 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BR0318; BS1330_I0319; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links

KEGG: bms:BR0318

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Brucella suis biovar 1 MscL protein?

The Brucella suis biovar 1 MscL is a full-length protein consisting of 138 amino acids. Its amino acid sequence is: MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLАГDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA . The protein functions as a mechanosensitive channel that responds to membrane tension. Research using homologous MscL proteins suggests it forms a multimeric complex in the bacterial inner membrane with a central pore that opens under mechanical force, releasing small molecules and ions to protect against osmotic shock .

How is recombinant Brucella suis MscL protein produced and purified for research?

Recombinant Brucella suis MscL protein is typically produced using E. coli expression systems. The full-length coding sequence (spanning amino acids 1-138) is cloned into an appropriate expression vector that incorporates an N-terminal His-tag for purification purposes . After expression in E. coli, the protein is purified using affinity chromatography, taking advantage of the His-tag. The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . The final product is often formulated as a lyophilized powder in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during storage .

What are the optimal storage and handling conditions for recombinant MscL protein?

For optimal stability and activity, recombinant Brucella suis MscL protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein integrity. Working aliquots may be stored at 4°C for up to one week . For reconstitution, it is recommended to briefly centrifuge the vial before opening and reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (typically 50%) is advised for long-term storage at -20°C or -80°C . These handling procedures are critical for maintaining protein functionality in experimental applications.

What are the unique identifiers and characteristics of Brucella suis MscL?

The Brucella suis biovar 1 MscL protein is identified by specific gene and protein identifiers in biological databases. For the biovar 1 strain 1330, the UniProt ID is Q8G2K1, with gene locus names BR0318 and BS1330_I0319 . For Brucella suis generally, the UniProt ID is B0CJU8 with the gene locus name BSUIS_A0347 . The protein is synonymously referred to as "Large-conductance mechanosensitive channel" in the scientific literature, and its gene name is consistently designated as mscL across Brucella species . These identifiers are essential for researchers to accurately find and reference the protein in databases and publications.

What methodologies are most effective for studying MscL channel function?

Research on mechanosensitive channels, including MscL, employs several sophisticated methodologies:

  • Patch Clamp Electrophysiology: This technique allows real-time measurement of channel activity in response to membrane tension. For MscL specifically, patch clamp recordings from reconstituted proteoliposomes enable determination of critical parameters such as pressure-tension relationships and channel conductance states .

  • Fluorescence Resonance Energy Transfer (FRET) Spectroscopy: This approach has been successfully used to measure structural rearrangements of MscL during gating while controlling the state of the pore in its natural lipid environment. The advantage of FRET is that structural changes can be measured under similar conditions as patch clamp recordings .

  • Combined Experimental-Simulation Approach: Integrating data from patch clamp and FRET spectroscopy with molecular dynamics and Brownian dynamics simulations provides comprehensive insights into channel function and structural rearrangements during gating .

These methodologies have revealed that MscL is not a simple binary channel but has multiple conducting states (at least four) plus a closed state, with the rate-limiting step being the transition between the closed state and the lowest conductance substate .

What are the biophysical parameters of MscL gating and how are they measured?

The gating of MscL channels can be quantitatively characterized by several biophysical parameters:

ParameterValueMethod of Determination
Midpoint tension (T₁/₂)11.8 dyn/cmPatch clamp on reconstituted liposomes
Slope sensitivity0.63 dyn/cm per e-foldAnalysis of open probability vs. tension
Energy difference (ΔE)18.6 kᴃTCalculated using Boltzmann distribution
In-plane area change (ΔA)6-6.5 nm²Derived from tension dependence of gating

These parameters are typically measured using patch clamp on giant liposomes, where membrane tension (T) is calculated from the pressure gradient (P) and radius of curvature measured via video microscopy. The probability of channel opening (Po) shows a steep sigmoidal dependence on tension . Analysis reveals that while MscL has multiple conducting states, the rate-limiting step to opening is the transition between the closed state and the lowest conductance substate, which involves the greatest change in membrane area .

How does Brucella suis utilize MscL in host-pathogen interactions and cellular immunity?

While the search results don't directly address MscL's role in Brucella suis pathogenicity, understanding of Brucella's interaction with host immunity provides context for potential MscL functions:

  • Intracellular Survival: Brucella suis is a facultative intracellular pathogen that can multiply extensively within normal monocytes of various mammals, often without observable toxic effects . MscL, as a membrane channel responding to osmotic pressure changes, may contribute to bacterial adaptation to the intracellular environment.

  • Immune Evasion Mechanisms: Brucella suis prevents dendritic cell maturation and antigen presentation through mechanisms involving bacterial proteins such as Omp25 . This suggests sophisticated adaptation to host cell environments where MscL might play a regulatory role.

  • Cellular Immunity: Studies show that "immune" monocytes derived from animals previously infected with smooth Brucella can restrict intracellular bacterial growth, suggesting acquired cellular immunity mechanisms . Understanding how MscL functions during these host-pathogen interactions could provide insights into bacterial adaptation strategies.

Research methodologies to investigate MscL's role in pathogenicity would include genetic approaches (gene knockout, complementation), infection models with wild-type and MscL-deficient strains, and comparative proteomic analyses of membrane fractions during infection.

How do the properties of Brucella suis MscL compare with MscL proteins from other bacterial species?

Mechanosensitive channels are widespread among bacteria, serving as osmotic safety valves. While the search results don't provide direct comparisons between Brucella suis MscL and those from other species, we can infer several research directions:

  • Sequence and Structural Homology: Comparative sequence analysis of MscL proteins across bacterial species would help identify conserved domains crucial for channel function versus species-specific adaptations. This approach typically involves multiple sequence alignment, phylogenetic analysis, and structural modeling.

  • Functional Conservation: Complementation studies, where Brucella suis mscL is expressed in MscL-deficient strains of other bacteria (such as E. coli), could determine functional conservation. Patch clamp analysis of the resulting channels would reveal similarities or differences in gating properties.

  • Pathogenicity Context: Unlike many environmental bacteria, Brucella is a host-adapted pathogen. Research could investigate whether its MscL has evolved specific properties related to intracellular survival in mammalian cells versus dealing with environmental osmotic stress.

Methodologically, such comparative studies would require recombinant expression of multiple MscL variants, purification under identical conditions, and parallel functional assays using reconstituted proteoliposomes.

What are the current challenges and future directions in MscL research related to Brucella pathogenesis?

Based on the search results and broader understanding of mechanosensitive channels and Brucella pathogenesis, several research challenges and opportunities emerge:

  • Structure-Function Relationship: While FRET studies have provided insights into MscL conformational changes, obtaining high-resolution structural data of Brucella suis MscL in different conformational states remains challenging. Cryo-electron microscopy combined with site-directed spin labeling could advance our understanding of channel dynamics.

  • Role in Virulence: Determining whether MscL contributes directly to Brucella virulence through functional studies in infection models is a critical research direction. This would involve creating mscL mutants and complemented strains, followed by virulence assessment in cellular and animal models.

  • Potential as Therapeutic Target: Investigating MscL as a potential target for anti-Brucella therapeutics presents an intriguing opportunity. High-throughput screening assays could identify compounds that specifically modulate MscL function, potentially compromising bacterial survival during infection.

  • Integration with Other Stress Responses: Understanding how MscL functions in concert with other stress response systems in Brucella would provide a more comprehensive picture of bacterial adaptation during infection. Transcriptomic and proteomic approaches under various stress conditions could help map these interactions.

  • Species-Specific Adaptations: Comparative studies of MscL across Brucella species and biovars (B. suis, B. abortus, B. melitensis) might reveal adaptations related to host preference and virulence differences, requiring systematic expression and characterization of these channel variants.

What reconstitution systems are most effective for functional studies of recombinant MscL?

For functional studies of recombinant MscL, liposome reconstitution systems have proven most effective. The methodology typically involves:

  • Liposome Preparation: Synthetic phospholipids (often a mixture mimicking bacterial membranes) are used to form liposomes through cycles of freezing and thawing followed by extrusion to create unilamellar vesicles of controlled size .

  • Protein Incorporation: Purified recombinant MscL protein is incorporated into preformed liposomes using detergents that are subsequently removed by dialysis or adsorption to hydrophobic beads .

  • Functional Verification: The resulting proteoliposomes can be used directly for patch clamp studies, where membrane patches are subjected to controlled pressure gradients to induce tension .

This approach allows precise control of lipid composition, protein concentration, and experimental conditions, enabling quantitative biophysical characterization of channel properties. Giant liposomes suitable for patch clamping can be formed through a dehydration-rehydration cycle of smaller proteoliposomes .

How can researchers integrate structural and functional data to better understand MscL mechanisms?

Integrating structural and functional data provides comprehensive insights into MscL mechanisms. Effective approaches include:

  • Combined Experimental Techniques: Using patch clamp electrophysiology together with FRET spectroscopy allows correlation of structural changes with functional states . This approach has revealed that transitions to the open state of MscL are less dramatic than previously proposed and that the N-terminus remains anchored at the membrane surface where it can translate membrane tension to conformational changes in the pore-lining helix .

  • Computational Modeling: Molecular dynamics and Brownian dynamics simulations informed by experimental data can predict channel behavior under conditions difficult to achieve experimentally . These simulations can test hypotheses about the mechanisms of channel gating and ion permeation.

  • Structure-Based Mutagenesis: Strategic amino acid substitutions based on structural models, followed by functional characterization, can validate the importance of specific residues and domains in channel function. This approach helps map the energy landscape of channel transitions.

  • Cross-Linking Studies: Chemical cross-linking combined with mass spectrometry can capture information about protein conformations and interactions during different functional states.

This integrated approach has revealed that MscL has multiple conducting states and that the rate-limiting step to channel opening is the transition between the closed state and the lowest conductance substate .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.