Recombinant Brucella suis biovar 1 Lectin-like protein BA14k (BRA0735, BS1330_II0728)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Brucella suis biovar 1 Lectin-like protein BA14k, also referred to as BRA0735 or BS1330_II0728, is a protein that has lectin-like properties and is produced using recombinant DNA technology . It was initially identified as an immunogenic protein in animals infected with Brucella species . The protein is a 14-kDa protein of B. abortus .

Brucella suis is a bacterium that causes brucellosis, a zoonotic disease . Brucella suis biovar 1 is one of the biovars (biologic variants) within the Brucella suis species . The protein BA14k, is present in Brucella abortus, which is known to cause abortions in cattle and undulant fever in humans .

FeatureDescription
NamesRecombinant Brucella suis biovar 1 Lectin-like protein BA14k
Other DesignationsBRA0735, BS1330_II0728
SpeciesBrucella suis biovar 1 (strain 1330)
Molecular Weight14 kDa
PropertiesLectin-like properties, immunoglobulin binding, and hemagglutination properties
FunctionContributes to virulence, possibly through direct or indirect involvement in the synthesis of smooth lipopolysaccharide (LPS). It is essential for the virulence of the Brucella species .

2.3. Post-translational Modifications

The post-translational modifications of Recombinant Brucella suis biovar 1 Lectin-like protein BA14k are not described in the the provided documents.

3.1. Recombinant Production

Recombinant BA14k protein is produced using genetic engineering techniques, where the gene encoding the protein is inserted into a host organism (e.g., yeast) to express and produce the protein in large quantities .

3.2. Availability

Recombinant Brucella suis biovar 1 Lectin-like protein BA14k is available for purchase from some vendors, generally for research purposes (e.g., ELISA) .

4.1. Lectin-like Properties

BA14k exhibits lectin-like properties, including immunoglobulin-binding and hemagglutination activities . Hemagglutination inhibition experiments suggest that the protein has an affinity towards mannose .

4.2. Role in Virulence

The 14-kDa protein of B. abortus is essential for the virulence of the species . Disruption of the gene encoding the 14-kDa protein in virulent B. abortus strain 2308 induces a rough-like phenotype with an altered smooth lipopolysaccharide (LPS) immunoblot profile . The mutant strain shows a significant reduction in its ability to replicate in mouse spleens . The BA14K lectin-like protein modulates LPS O-chain content, though the precise mechanism is not yet known .

4.3. Interaction with Host Cells

Brucella species employ various strategies for intracellular survival, including secreting proteins that can inhibit TNF-α production in human macrophages . Brucella LPS has lower biological activity compared to enterobacterial LPS, contributing to the survival of these pathogens in phagocytic cells .

5.1. ELISA

Recombinant Brucella suis biovar 1 Lectin-like protein BA14k can be used in Enzyme-Linked Immunosorbent Assays (ELISA) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BRA0735; BS1330_II0728; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
BRA0735
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function

This lectin-like protein exhibits immunoglobulin-binding and hemagglutination properties, and binds to mannose. It is crucial for virulence and may participate in lipopolysaccharide (LPS) biosynthesis or polysaccharide transport.

Database Links

KEGG: bms:BRA0735

Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.