Recombinant Brucella suis biovar 1 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella suis Biovar 1 Membrane Protein Insertase YidC

Recombinant Brucella suis biovar 1 YidC is a full-length membrane protein insertase (UniProt ID: Q8FV29) critical for co-translational membrane protein integration in bacteria. Expressed in E. coli as a His-tagged fusion protein (1-610 amino acids), it facilitates the insertion of hydrophobic transmembrane domains into lipid bilayers, either independently or in conjunction with the Sec translocase . This protein is essential for bacterial membrane biogenesis and has emerged as a research tool for studying membrane protein assembly and pathogenic mechanisms in Brucella species.

Key Features of Recombinant YidC

PropertyDescription
SourceE. coli expression system
TagN-terminal His-tag (for purification)
Protein LengthFull-length (1-610 residues)
Purity>90% (SDS-PAGE validated)
Storage-20°C/-80°C (lyophilized powder); avoid freeze-thaw cycles
ReconstitutionDeionized water (0.1–1.0 mg/mL); 50% glycerol recommended for stability

Domain Architecture

YidC contains five conserved transmembrane (TM) domains and a cytoplasmic helical hairpin between TM2 and TM3 . Structural models suggest:

  • TM1–TM5: Form a channel-like structure for substrate binding.

  • Helical Hairpin: Interacts with ribosomes during co-translational insertion .

  • Lipid Interface: Provides a hydrophilic environment for membrane protein insertion .

Mechanism of Action

  1. Membrane Protein Insertion:

    • Binds nascent polypeptide chains at the ribosome exit .

    • Guides hydrophobic TM domains into lipid bilayers via a "hydrophilic gate" mechanism .

    • Functions independently or with SecYEG to resolve topological complexity .

  2. Substrate Specificity:

    • Targets single-spanning membrane proteins (e.g., Pf3 coat protein) and multi-TM proteins .

    • Accelerates insertion of extended hydrophobic regions in Sec-independent substrates .

Immunogenicity in Brucella

YidC is identified as an immunogenic protein in Brucella proteomics studies, highlighting its potential as a vaccine target or serodiagnostic antigen .

Experimental Use Cases

ApplicationMethodology/Outcome
Vaccine DevelopmentELISA assays using recombinant YidC to identify immunogenic epitopes
Membrane Insertion StudiesReconstitution into proteoliposomes to study TM domain integration efficiency
Structural BiologyCryo-EM docking to map ribosome-YidC interactions during translation

Key Research Findings

  • Ribosome Interaction: Single YidC monomers bind ribosomes at the tunnel exit, guiding substrates into membranes .

  • Lipid Bilayer Thinning: YidC reduces bilayer thickness, lowering the energy barrier for hydrophilic loop insertion .

  • Evolutionary Conservation: Functional homology with mitochondrial Oxa1 and chloroplast Alb3 in membrane protein biogenesis .

Comparative Analysis with Other YidC Homologs

FeatureBrucella suis YidCE. coli YidCMitochondrial Oxa1
Expression SystemRecombinant E. coli Native bacterial system Mitochondrial matrix
Key SubstratesMembrane proteins (e.g., ATP synthase) Sec-independent proteins (e.g., Pf3) Respiratory complex subunits
Structural Motifs5 TM domains + helical hairpin 5 TM domains + ribosome-binding domain 5 TM domains + C-terminal tail

Challenges and Future Directions

  • Limited Strain-Specific Data: Most functional studies rely on E. coli YidC; targeted studies on Brucella suis biovar 1 YidC are needed.

  • Therapeutic Potential: YidC’s role in bacterial virulence and membrane protein biogenesis positions it as a novel antimicrobial target.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; BRA1023; BS1330_II1015; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
yidC
Target Protein Sequence
MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT YVLHEGLIGVMGQDGLQEIKYAKIKDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM QPKMTEIREKYADDKMKQQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEM RHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPPD PTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGL FRRKPKEANK
Uniprot No.

Target Background

Function

This protein is essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a crucial role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as some lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.

Database Links

KEGG: bms:BRA1023

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what are its primary functions in bacteria?

YidC is a universally conserved membrane protein insertase responsible for facilitating the insertion and proper folding of proteins into the cytoplasmic membrane of bacteria. YidC serves two primary functions: it can act in combination with the Sec translocon to assist in the insertion and folding of membrane proteins, and it can function independently as an insertase for "YidC-only" substrates . Additionally, YidC can act as a foldase, promoting the proper assembly of membrane protein complexes . This dual functionality makes YidC essential for bacterial survival as it ensures the correct integration of proteins that perform vital cellular functions.

How does the Brucella suis biovar 1 YidC compare structurally to YidC from other bacterial species?

The Brucella suis biovar 1 YidC protein consists of 610 amino acids with multiple transmembrane domains . While the specific structural details of B. suis YidC have not been fully characterized in the provided research, comparative analysis with the E. coli YidC suggests a conserved arrangement of five transmembrane domains (TM2-TM6) that form the functional core, with TM1 being less conserved . Similar to other bacterial YidC proteins, the B. suis variant likely contains a periplasmic domain (P1) between TM1 and TM2, though this domain often exhibits flexibility relative to the conserved membrane region . The core transmembrane arrangement facilitates interaction with nascent membrane proteins and the ribosome during co-translational insertion.

What are the primary YidC-only substrates identified in bacterial systems?

Several YidC-only substrates have been identified in bacterial systems, particularly in E. coli. These substrates typically have short translocated regions and include:

  • F₁F₀-ATPase subunit c

  • M13 phage procoat protein

  • Mechano-sensing MscL protein

  • Sci-1 type VI secretion system subunit TssL

  • Pf3 coat protein

These proteins can be inserted into the membrane without requiring the Sec translocon, relying solely on the insertase activity of YidC. This makes them valuable model substrates for studying the independent insertase function of YidC in various bacterial species, including potentially in Brucella suis.

How is recombinant YidC typically produced for research applications?

Recombinant YidC for research applications is typically produced using bacterial expression systems. For the Brucella suis biovar 1 YidC specifically, the full-length protein (amino acids 1-610) is expressed in E. coli with an N-terminal His tag to facilitate purification . The protein is generally obtained in a lyophilized powder form and can be reconstituted in appropriate buffers. For long-term storage, it is recommended to store the protein at -20°C/-80°C with the addition of 5-50% glycerol (final concentration) to prevent damage from freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, though repeated freezing and thawing should be avoided to maintain protein integrity.

What methods are most effective for studying YidC-mediated membrane protein insertion in vitro?

For studying YidC-mediated membrane protein insertion in vitro, several complementary approaches have proven effective:

  • Reconstitution systems: Purified YidC can be reconstituted into proteoliposomes to study its insertase activity independent of other cellular components . This approach allows researchers to directly assess YidC's ability to facilitate membrane protein insertion without confounding factors.

  • Ribosome-nascent chain complexes (RNCs): RNCs carrying YidC substrates can be purified and incubated with purified YidC to study co-translational insertion . This system closely mimics the physiological process and enables structural studies of the insertion process.

  • Disulfide crosslinking analysis: This technique involves introducing cysteine residues at specific positions in both YidC and the substrate protein. For example, researchers have successfully used this approach by creating F₀c (G23C)-RNCs and single cysteine mutants of YidC . The formation of disulfide bonds between YidC and the nascent chain can be induced using crosslinking agents like DTNB (5,5'-dithiobis-2-nitrobenzoic acid) and analyzed by SDS-PAGE and western blotting to identify points of contact during insertion .

  • Cryo-electron microscopy: This technique has been used to visualize YidC-ribosome complexes at high resolution (~8Å), providing insights into how YidC interacts with the ribosome and facilitates nascent chain insertion . This approach is particularly valuable for understanding the structural basis of YidC function.

What critical residues in YidC are essential for its interaction with the ribosome during co-translational insertion?

Based on structural and functional studies, several critical residues in YidC have been identified as essential for its interaction with the ribosome during co-translational insertion:

ResidueLocationInteraction PartnerEffect of Mutation
Y370Cytoplasmic regionRibosomal RNA helix 59Severe loss of function
Y377Cytoplasmic regionRibosomal RNA helix 59Severe loss of function
D488Cytoplasmic regionRibosomal protein uL23Severe loss of function when mutated to lysine

These residues appear to form direct contacts with the ribosome at the exit tunnel, positioning YidC optimally to receive the nascent membrane protein as it emerges from the ribosome. Mutations at these positions severely impair YidC function in complementation assays despite stable expression of the mutant proteins, highlighting their crucial role in co-translational membrane protein insertion .

How do molecular dynamics simulations contribute to understanding YidC structure-function relationships?

Molecular dynamics (MD) simulations have provided valuable insights into the structure-function relationships of YidC by:

What experimental approaches can differentiate between YidC's roles as an insertase versus a foldase?

Differentiating between YidC's insertase and foldase functions requires specific experimental approaches:

  • Membrane insertion assays: These assays measure the efficiency of protein integration into the membrane. For example, protease protection assays can determine whether a substrate is properly inserted into the membrane by assessing which portions are accessible to proteases .

  • Folding assessment techniques:

    • Activity assays for the substrate protein can determine whether it is properly folded and functional

    • Conformation-specific antibodies can detect correctly folded structures

    • Limited proteolysis can reveal the accessibility of certain regions, indicating proper folding

  • Penicillin binding protein (PBP) folding studies: Research has shown that in the absence of YidC, certain PBPs are not correctly folded even though their total amount in the membrane remains unchanged . This indicates that YidC's role extends beyond insertion to include proper folding of periplasmic domains of membrane proteins.

  • Complementation studies with YidC mutants: By creating YidC variants with selective defects in either insertion or folding functions, researchers can determine which function is required for specific substrates .

  • In vivo versus in vitro approaches: Comparing results from in vivo complementation assays with in vitro reconstitution experiments can help distinguish between the two functions, as certain artifacts or limitations may be present in one system but not the other .

How can evolutionary covariation analysis be applied to predict structural features of YidC proteins from different bacterial species?

Evolutionary covariation analysis is a powerful approach for predicting structural features of membrane proteins like YidC:

For YidC, this approach successfully predicted seven helix-helix contacts with probabilities above 57%, while all other possible contacts scored below 15%, demonstrating the specificity of the method . The resulting model showed good agreement with subsequently determined crystal structures, validating the approach for structural prediction of membrane proteins.

What functional differences exist between YidC proteins from pathogenic bacteria like Brucella suis compared to model organisms like E. coli?

While both Brucella suis and E. coli YidC proteins share the fundamental function of membrane protein insertion, several functional differences may exist:

  • Substrate specificity: The YidC from B. suis may have evolved to preferentially insert specific virulence factors or proteins unique to this pathogen's lifestyle. This could include proteins involved in host invasion, intracellular survival, or evasion of host immune responses.

  • Environmental adaptation: B. suis, as an intracellular pathogen, encounters different membrane environments compared to E. coli. Its YidC may have adapted to function optimally under the specific pH, temperature, and lipid composition conditions found within host cells.

  • Regulatory mechanisms: The expression and activity of YidC in B. suis might be regulated differently than in E. coli, potentially responding to host-derived signals or stress conditions unique to the pathogen's lifecycle.

  • Interaction partners: While the core mechanism of membrane insertion may be conserved, B. suis YidC might interact with species-specific accessory proteins that facilitate insertion of particular substrates relevant to pathogenesis.

  • Structural features: The full-length B. suis YidC (610 amino acids) may contain specific structural elements that differentiate it from E. coli YidC, potentially affecting its function or localization within the bacterial cell .

Further comparative studies between the two proteins would be necessary to fully characterize these potential differences and their implications for bacterial physiology and pathogenesis.

What are the optimal conditions for reconstituting lyophilized recombinant YidC for functional studies?

For optimal reconstitution of lyophilized recombinant YidC:

  • Initial preparation: Briefly centrifuge the vial containing lyophilized YidC prior to opening to bring the contents to the bottom .

  • Reconstitution buffer: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The storage buffer is typically Tris/PBS-based with 6% trehalose at pH 8.0 .

  • Glycerol addition: Add 5-50% glycerol (final concentration) to enhance protein stability. The recommended default final concentration is 50% .

  • Aliquoting: Prepare small aliquots for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles, which can damage the protein .

  • Working conditions: Working aliquots can be stored at 4°C for up to one week .

  • Functional verification: After reconstitution, it is advisable to verify protein activity using functional assays such as ribosome binding assays or membrane insertion assays to ensure the reconstituted protein has maintained its activity.

What methods are most effective for analyzing YidC-substrate interactions during membrane protein insertion?

Several complementary methods have proven effective for analyzing YidC-substrate interactions:

  • Site-specific crosslinking: This approach involves introducing crosslinkable amino acids or cysteine residues at specific positions in both YidC and the substrate protein. For example:

    • Disulfide crosslinking has been successfully used with F₀c (G23C)-RNCs and single cysteine mutants of YidC, with crosslinks induced using 1 mM DTNB and quenched with 20 mM NEM .

    • Crosslinked complexes can be separated using sucrose gradient centrifugation and analyzed by SDS-PAGE and western blotting .

  • Cryo-electron microscopy: This technique has been used to visualize YidC-ribosome complexes with nascent chains at high resolution, providing structural insights into the insertion process . The improved resolution of ~8Å allows for detailed interpretation of the YidC-substrate interaction.

  • FRET (Förster Resonance Energy Transfer): By labeling YidC and substrate proteins with fluorescent donor and acceptor pairs, researchers can monitor real-time interactions during the insertion process.

  • In vivo complementation assays: Systematic mutation of residues in YidC can identify those critical for substrate interaction. For example, mutations of residues T362 in TM2 and Y517 in TM6 completely inactivated YidC function, suggesting their importance in substrate handling .

  • Molecular dynamics simulations: These computational approaches can predict and analyze potential interaction sites between YidC and its substrates, providing testable hypotheses for experimental validation .

How can researchers effectively compare the function of YidC from Brucella suis with homologs from other bacterial species?

To effectively compare YidC function across bacterial species:

  • Heterologous complementation assays: Express B. suis YidC in E. coli YidC depletion strains (such as FTL10) and assess whether it can complement the loss of endogenous YidC . This approach can reveal functional conservation or divergence.

  • Substrate insertion assays: Test the ability of B. suis YidC to insert known YidC-only substrates (F₁F₀-ATPase subunit c, M13 phage procoat, MscL, etc.) compared to E. coli YidC . Differences in efficiency may indicate substrate preference or mechanistic variations.

  • Chimeric protein analysis: Create chimeric proteins containing domains from both B. suis and E. coli YidC to identify regions responsible for species-specific functions.

  • Structural comparison: Compare the structural features of B. suis YidC with those of other bacterial YidCs using techniques such as:

    • Evolutionary covariation analysis

    • Lipid exposure prediction

    • Molecular dynamics simulations

  • Ribosome binding studies: Compare the interaction of B. suis YidC with ribosomes to that of other species. Focus on residues known to be critical for ribosome binding in E. coli YidC (Y370, Y377, D488) and determine if these interactions are conserved.

  • Mutational analysis: Introduce mutations at conserved residues and assess their impact on function across different species to identify mechanistically important regions.

What are the key considerations for designing site-directed mutagenesis experiments to study YidC function?

When designing site-directed mutagenesis experiments for YidC functional studies, researchers should consider:

  • Target selection based on structural information:

    • Focus on residues in the transmembrane domains that may participate in substrate binding

    • Target residues that stabilize the protein core (e.g., T362 in TM2 and Y517 in TM6)

    • Investigate residues at the ribosome-binding interface (Y370, Y377, D488)

  • Conservation analysis:

    • Prioritize highly conserved residues across bacterial species

    • Consider residues identified through evolutionary covariation analysis

  • Mutation type selection:

    • Conservative mutations (maintaining physicochemical properties) to test subtle functional effects

    • Non-conservative mutations (changing charge, size, or hydrophobicity) to disrupt specific interactions

    • Alanine scanning to remove side chain contributions while maintaining backbone structure

  • Functional assessment methods:

    • In vivo complementation assays using YidC depletion strains like E. coli FTL10

    • Membrane insertion assays for specific substrate proteins

    • Ribosome binding assays to evaluate co-translational activity

  • Expression verification:

    • Always confirm that mutant proteins are stably expressed to distinguish between functional defects and expression/stability issues

    • Western blotting or other protein detection methods should be employed

  • Control mutations:

    • Include known functionally important residues as positive controls

    • Include mutations in non-essential regions as negative controls

What approaches are most effective for studying the co-translational activity of YidC during membrane protein insertion?

To study the co-translational activity of YidC during membrane protein insertion, researchers can employ several effective approaches:

  • Ribosome-nascent chain complex (RNC) preparation:

    • Generate stalled translation complexes with ribosome-bound nascent chains of varying lengths

    • For example, create F₀c-RNCs with the first transmembrane helix exposed outside the ribosomal tunnel

  • Cryo-electron microscopy of YidC-ribosome complexes:

    • Reconstitute complexes by incubating RNCs with purified YidC

    • Use cryo-EM to visualize the structural arrangement at high resolution (~8Å)

    • This approach has successfully revealed how YidC interacts with the ribosome at the exit tunnel and identified the site for membrane protein insertion at the YidC protein-lipid interface

  • Crosslinking analysis during co-translational insertion:

    • Introduce cysteine residues at specific positions in both YidC and the nascent chain

    • Induce disulfide crosslinking using agents like DTNB

    • Analyze crosslinked complexes by sucrose gradient centrifugation and western blotting

  • Real-time fluorescence techniques:

    • Label YidC and/or nascent chains with fluorescent markers

    • Monitor the insertion process in real-time using techniques like FRET or fluorescence correlation spectroscopy

  • Ribosome binding mutant analysis:

    • Create YidC variants with mutations at the ribosome-binding interface (e.g., Y370A, Y377A, D488K)

    • Assess their effect on co-translational insertion efficiency

  • In vitro translation-insertion systems:

    • Develop coupled translation-insertion systems using purified components

    • This allows for controlled manipulation of the process and detailed mechanistic studies

These approaches together provide complementary insights into the co-translational activity of YidC and its mechanism of action during membrane protein insertion.

What are common challenges in expressing and purifying functional recombinant YidC, and how can they be addressed?

Common challenges in expressing and purifying functional recombinant YidC include:

  • Membrane protein expression levels:

    • Challenge: As a membrane protein, YidC often expresses at low levels

    • Solution: Optimize expression conditions (temperature, inducer concentration, duration); use specialized expression strains designed for membrane proteins; consider fusion tags that enhance expression

  • Protein aggregation and inclusion body formation:

    • Challenge: Overexpressed membrane proteins often aggregate

    • Solution: Lower expression temperature (16-20°C); use mild induction; co-express with chaperones; consider cell-free expression systems

  • Detergent selection for extraction:

    • Challenge: Finding detergents that efficiently extract YidC while maintaining its native structure

    • Solution: Screen multiple detergents (mild non-ionic detergents like DDM or LMNG often work well); consider detergent mixtures; optimize detergent concentration

  • Maintaining stability during purification:

    • Challenge: YidC may lose activity during purification steps

    • Solution: Include stabilizing agents (glycerol, specific lipids); minimize purification steps; maintain cold temperatures throughout

  • Proper reconstitution after lyophilization:

    • Challenge: Ensuring proper refolding after lyophilization

    • Solution: Follow optimized reconstitution protocols with appropriate buffers (Tris/PBS-based buffer with 6% trehalose at pH 8.0) ; add glycerol (5-50%) to prevent damage from freeze-thaw cycles

  • Verifying functional activity:

    • Challenge: Confirming that purified YidC retains insertase activity

    • Solution: Develop functional assays (ribosome binding, substrate insertion); compare activity to control preparations

How can researchers distinguish between insertion defects and folding defects when studying YidC mutants?

Distinguishing between insertion and folding defects requires multiple complementary approaches:

  • Membrane localization assays:

    • Insertion focus: Determine if the substrate protein is present in the membrane fraction

    • Method: Cell fractionation followed by western blotting or protease accessibility assays

  • Topological analysis:

    • Insertion focus: Assess whether transmembrane segments are properly oriented

    • Methods: Cysteine accessibility, reporter fusion assays, or protease protection assays

  • Functional activity measurements:

    • Folding focus: Test if the substrate protein is functionally active

    • Method: Activity assays specific to the substrate protein

  • Structural integrity assessment:

    • Folding focus: Evaluate if the protein has achieved its correct tertiary structure

    • Methods: Limited proteolysis, conformation-specific antibodies, or thermal stability assays

  • Comparative analysis with known substrates:

    • Use substrates with well-characterized insertion vs. folding requirements

    • For example, research has shown that certain penicillin binding proteins (PBPs) are not correctly folded in the absence of YidC even though their total amount in the membrane is not affected

  • Targeted YidC mutations:

    • Create YidC variants with mutations in domains specifically involved in either insertion or folding

    • Compare the effects of these mutations on different substrate proteins

  • Time-course experiments:

    • Monitor the appearance of the substrate in the membrane versus the acquisition of functional activity

    • A temporal separation between these events can help distinguish insertion from folding

What are the most reliable methods for assessing the structural integrity of purified recombinant YidC?

To assess the structural integrity of purified recombinant YidC, researchers can employ several reliable methods:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure content (α-helices, β-sheets)

    • Can confirm that the purified YidC maintains its predominantly α-helical structure

    • Temperature-dependent CD can assess thermal stability

  • Tryptophan Fluorescence Spectroscopy:

    • Measures the local environment of tryptophan residues

    • Changes in fluorescence can indicate alterations in tertiary structure

    • Useful for monitoring conformational changes upon substrate binding

  • Size Exclusion Chromatography (SEC):

    • Assesses the oligomeric state and homogeneity of the purified protein

    • Can detect aggregation or degradation

    • When coupled with multi-angle light scattering (SEC-MALS), provides accurate molecular weight determination

  • Limited Proteolysis:

    • Properly folded proteins typically show resistance to proteolysis at specific sites

    • Compare digestion patterns between wild-type and potentially misfolded variants

  • Thermal Stability Assays:

    • Differential scanning fluorimetry (DSF) or nanoDSF can measure protein unfolding temperatures

    • Higher melting temperatures generally indicate more stable protein conformations

  • Functional Assays:

    • Ribosome binding ability

    • Substrate insertion activity

    • These directly test whether the protein maintains its functional capabilities

  • Cryo-electron Microscopy:

    • Can provide structural information about the purified protein

    • Particularly useful when reconstituted with binding partners like ribosomes

  • Molecular Dynamics Simulations:

    • Can predict the stability of the protein structure in different environments

    • Has been successfully used to assess YidC stability in membrane environments

What quality control parameters should be monitored when working with recombinant YidC for insertion assays?

When working with recombinant YidC for insertion assays, several quality control parameters should be monitored:

  • Protein Purity:

    • SDS-PAGE analysis to confirm >90% purity as specified for commercially available recombinant YidC

    • Mass spectrometry to verify protein identity and detect potential contaminants

  • Protein Concentration:

    • Accurate determination using methods suitable for membrane proteins (BCA assay, amino acid analysis)

    • Ensure consistent concentration between experiments (0.1-1.0 mg/mL is typically recommended)

  • Structural Integrity:

    • Circular dichroism to confirm secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

    • Size exclusion chromatography to detect aggregation

  • Functional Activity:

    • Ribosome binding assays to confirm interaction with ribosomes

    • Control insertion assays with well-characterized substrates

    • Comparison with positive controls (fresh preparations of known active YidC)

  • Reconstitution Parameters:

    • For proteoliposome reconstitution: protein-to-lipid ratio, liposome size distribution

    • For detergent-solubilized preparations: detergent type and concentration

    • Buffer composition (pH 8.0 Tris/PBS-based buffer with 6% trehalose is recommended)

  • Storage Conditions:

    • Monitoring stability during storage (avoid repeated freeze-thaw cycles)

    • Use of appropriate stabilizing agents (5-50% glycerol)

    • Storage temperature (-20°C/-80°C for long-term; 4°C for working aliquots up to one week)

  • Batch-to-Batch Consistency:

    • Standardized activity assays to compare different preparations

    • Documentation of source material, purification procedure, and yield

  • Control Experiments:

    • Negative controls (inactive YidC mutants)

    • Positive controls (known substrate proteins with well-characterized insertion patterns)

Monitoring these parameters will ensure reliable and reproducible results when using recombinant YidC for membrane protein insertion studies.

What are the comparative advantages and limitations of in vivo versus in vitro approaches for studying YidC function?

Understanding the comparative advantages and limitations of in vivo versus in vitro approaches is crucial for designing appropriate experiments to study YidC function:

AspectIn Vivo ApproachesIn Vitro Approaches
Physiological RelevanceAdvantage: Native cellular environment with all cofactors and interaction partners present
Limitation: Complex cellular background can complicate interpretation
Advantage: Controlled conditions allow specific mechanistic questions
Limitation: May lack important cellular factors that influence function
Experimental ControlAdvantage: Allows study of YidC in its natural context
Limitation: Difficult to control specific parameters
Advantage: Precise control over protein concentrations, buffer conditions, etc.
Limitation: Simplified system may not replicate all aspects of in vivo function
Temporal ResolutionAdvantage: Can study long-term effects on cell physiology
Limitation: Often limited to endpoint measurements
Advantage: Can monitor insertion in real-time with appropriate assays
Limitation: May not capture long-term effects or complex regulatory mechanisms
Methodology Examples- Complementation assays with YidC mutants
- Depletion strains (e.g., E. coli FTL10)
- In vivo crosslinking
- Reporter fusion assays
- Reconstituted proteoliposomes
- Purified YidC-ribosome complexes
- Cryo-EM structural studies
- Disulfide crosslinking with purified components
Data InterpretationAdvantage: Directly shows physiological significance
Limitation: Difficult to distinguish direct from indirect effects
Advantage: Clear cause-effect relationships
Limitation: May not reflect the complexity of cellular processes
Technical ConsiderationsAdvantage: Often technically simpler to implement
Limitation: Limited options for manipulating the system
Advantage: Highly versatile experimental design
Limitation: Technically challenging, especially for membrane proteins

For comprehensive understanding of YidC function, combining both approaches is optimal. For example, researchers have used in vivo complementation assays to verify the functional importance of residues identified through in vitro structural studies of YidC-ribosome complexes . This integrated approach provides both mechanistic insights and physiological relevance.

What aspects of YidC structure and function remain poorly understood and represent promising research opportunities?

Several aspects of YidC structure and function remain poorly understood and offer promising research opportunities:

  • Substrate recognition mechanisms:

    • How does YidC recognize diverse substrate proteins?

    • What features distinguish YidC-only substrates from those requiring the Sec translocon?

    • Are there specific sequence or structural motifs that determine substrate preference?

  • Species-specific functions:

    • How do pathogen-specific YidC proteins, like that from Brucella suis, differ functionally from model organisms?

    • Do these differences contribute to pathogenesis or host adaptation?

    • Could species-specific functions offer potential antimicrobial targets?

  • Regulatory mechanisms:

    • How is YidC activity regulated in response to cellular conditions?

    • Are there post-translational modifications that affect YidC function?

    • How is YidC expression coordinated with other components of membrane protein insertion pathways?

  • Detailed molecular mechanism of insertion:

    • What are the precise conformational changes during the insertion process?

    • How does YidC facilitate the transfer of hydrophobic transmembrane segments into the lipid bilayer?

    • What is the energetic basis for YidC-mediated insertion?

  • YidC-lipid interactions:

    • How do specific lipids influence YidC structure and function?

    • Are there lipid requirements for optimal activity?

    • How does the local membrane environment affect insertion efficiency?

  • Higher-order complexes:

    • Does YidC form functional dimers or higher-order oligomers in vivo?

    • How does YidC cooperate with other membrane protein biogenesis factors beyond the Sec translocon?

  • Folding mechanism:

    • How does YidC facilitate the proper folding of membrane proteins?

    • What distinguishes YidC's insertase function from its foldase function?

    • How does YidC assist in the assembly of multiprotein complexes?

How might structural information on YidC be leveraged for antimicrobial development against Brucella suis and other pathogens?

Structural information on YidC could be leveraged for antimicrobial development through several strategies:

  • Structure-based inhibitor design:

    • Target the substrate-binding site with small molecules that compete with natural substrates

    • Design compounds that disrupt the YidC-ribosome interaction, targeting critical residues like Y370, Y377, and D488

    • Develop peptides mimicking essential substrate recognition motifs

  • Exploitation of species-specific features:

    • Identify structural differences between pathogen YidC (e.g., Brucella suis) and human mitochondrial or host YidC homologs

    • Target these differences to achieve selectivity and minimize toxicity

    • Focus on regions unique to the pathogen that might be involved in virulence factor insertion

  • Disruption of critical stabilizing interactions:

    • Target key stabilizing residues identified through molecular dynamics simulations, such as T362 in TM2 and Y517 in TM6

    • Design compounds that destabilize these interactions, potentially leading to YidC misfolding or dysfunction

  • Interference with YidC-specific substrates:

    • Identify virulence factors in Brucella suis that depend on YidC for insertion

    • Design inhibitors that specifically block the insertion of these critical substrates

  • Allosteric inhibition:

    • Target allosteric sites that, when bound, induce conformational changes that prevent YidC function

    • Such sites might be more accessible than the substrate-binding groove

  • Combination approaches:

    • Develop inhibitors that simultaneously target YidC and other components of membrane protein insertion pathways

    • This multi-target approach could reduce the likelihood of resistance development

  • Screening platforms:

    • Develop high-throughput screening assays based on YidC structure and function

    • Use reconstituted systems with purified components to identify compounds that inhibit YidC activity

Since YidC is essential for bacterial survival and lacks close homologs in mammalian cells, it represents a promising target for new antimicrobials against difficult-to-treat pathogens like Brucella suis.

How might advances in computational methods enhance our understanding of YidC-mediated membrane protein insertion?

Advances in computational methods offer numerous opportunities to enhance our understanding of YidC-mediated membrane protein insertion:

  • Improved evolutionary covariation analysis:

    • More sophisticated algorithms for detecting coevolving residues can provide higher-resolution structural predictions

    • Integration of machine learning approaches can improve the accuracy of contact prediction

    • These methods have already proven valuable in developing structural models of YidC

  • Enhanced molecular dynamics simulations:

    • Longer simulation timescales can capture slower conformational changes during insertion

    • Coarse-grained simulations can model larger systems including multiple copies of YidC, ribosomes, and nascent chains

    • Advanced sampling techniques can explore rare events in the insertion process

    • MD simulations have already provided insights into YidC stability and interactions

  • Quantum mechanics/molecular mechanics (QM/MM) approaches:

    • Can provide insights into the energetics of specific interactions during insertion

    • May help understand the role of charged or polar residues within the membrane environment

  • Machine learning for substrate prediction:

    • Develop algorithms to predict which membrane proteins require YidC for insertion

    • Identify sequence or structural features that determine YidC dependence

    • Could help expand the known repertoire of YidC substrates

  • Integrative modeling approaches:

    • Combine data from various experimental sources (cryo-EM, crosslinking, functional assays) with computational predictions

    • Create comprehensive models of the entire insertion process

    • This approach has been successful in modeling YidC-ribosome complexes

  • Network analysis of membrane protein biogenesis:

    • Model the interplay between YidC, the Sec translocon, and other factors

    • Predict the effects of perturbations to this network

    • Identify potential compensatory mechanisms

  • Simulation of lipid-protein interactions:

    • Specialized force fields for lipid-protein interactions can model how the membrane environment affects YidC function

    • Predict how local membrane composition influences insertion efficiency

These computational approaches, especially when integrated with experimental data, promise to significantly advance our understanding of the complex process of YidC-mediated membrane protein insertion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.