Recombinant Brucella suis biovar 1 Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Recombinant Brucella suis Biovar 1 Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA): Overview

The recombinant Brucella suis biovar 1 monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a His-tagged protein expressed in E. coli and purified for research purposes. This enzyme catalyzes the glycosyltransferase activity of peptidoglycan biosynthesis, synthesizing linear glycan chains from lipid-linked precursors. Unlike typical penicillin-binding proteins (PBPs), mtgA lacks a transpeptidase domain, making it a monofunctional enzyme critical for bacterial cell wall integrity .

Biological Role in Brucella Pathogenesis

mtgA is essential for maintaining peptidoglycan layer stability, particularly under intracellular stress conditions. Key findings include:

  • Intracellular Induction: mtgA expression is upregulated during infection, suggesting a role in resisting phagosome-derived stressors .

  • Cell Wall Integrity: Mutants lacking mtgA exhibit defects in intracellular survival, indicating compromised cell wall synthesis during host infection .

  • Viralence Factor: mtgA contributes to Brucella’s ability to evade host immune responses by preserving structural integrity, enabling persistence in macrophages .

Research Findings from Transposon Mutagenesis

Mutant ClassInternalizationIntracellular GrowthAssociated Genes
Class INoneNonevirB, ion transporters
Class IIWild-type levelsDefectiveBiosynthesis/metabolism genes
Class III2× wild-type levelsDefectivemtgA, surface proteins

Transposon insertion in mtgA (Class III mutants) increases adherence to host cells but abolishes intracellular growth, highlighting its dual role in structural maintenance and immune evasion .

Applications in Research and Drug Development

  • Antibiotic Target: mtgA’s absence in mammalian cells makes it a potential target for novel antimicrobials. Inhibitors targeting mtgA could disrupt peptidoglycan synthesis selectively in Brucella .

  • Diagnostic Marker: Recombinant mtgA is used in serological assays to detect Brucella infections, leveraging its immunogenicity .

  • Structural Studies: The His-tagged recombinant protein facilitates X-ray crystallography and biochemical assays to elucidate its catalytic mechanism .

Functional Comparison with Related Enzymes

EnzymeFunctionPBP DomainPenicillin Sensitivity
mtgAGlycosyltransferase (peptidoglycan)NoneResistant
High-Molecular-Weight PBPsGlycosyltransferase + TranspeptidasePresentSensitive

mtgA’s monofunctional activity distinguishes it from PBPs, making it a unique target for anti-Brucella strategies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; BR1776; BS1330_I1770; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
mtgA
Target Protein Sequence
MWGSRIAVALRILVVLAILPVFLLLVYSLPFVRPVSTLMVKDYALLQGVNRQWVDIENIA PVLVNSVMMAEDGQFCSHGGVDWHQLGLVLDDAGDGGPSRGASTITMQMVKNLFLWNGRS YLRKGLEFPLALIADAVLSKKRIMEIYLNIAEWGPGIYGIEAAARHYFKRSAAKLTARQA ALLAVTLPNPALRNPAKPTRNMQRIARIVAGRAMRSGPYVTCVK
Uniprot No.

Target Background

Function
Peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: bms:BR1776

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of peptidoglycan transglycosylase in Brucella suis biovar 1 pathogenesis?

Peptidoglycan transglycosylase plays a critical role in Brucella suis biovar 1 pathogenesis by mediating the synthesis of peptidoglycan, a key component of the bacterial cell wall. This enzyme catalyzes the polymerization of glycan strands consisting of alternating N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) residues. As an obligate intracellular pathogen, Brucella suis must carefully regulate its peptidoglycan synthesis to avoid detection by host immune surveillance mechanisms while maintaining structural integrity . The essentiality of peptidoglycan for survival in hypoosmolar environments and its role in anchoring virulence determinants makes mtgA an important factor in Brucella pathogenicity.

How does mtgA activity differ between Brucella suis biovar 1 and other Brucella species?

While sharing core enzymatic functions, mtgA in Brucella suis biovar 1 exhibits specific characteristics that may contribute to its broader host range compared to other Brucella species. B. suis biovar 1 has the broadest animal host spectrum among Brucella species, affecting both domestic animals and wildlife . This expanded host range may be partially attributed to variations in cell wall composition and modification that allow it to adapt to diverse host environments. Specifically, the peptidoglycan structure in B. suis biovar 1 may be modified in ways that help evade host immune recognition while maintaining structural integrity within various host cells.

How do host peptidoglycan recognition proteins interact with Brucella suis peptidoglycan components?

Host peptidoglycan recognition proteins interact with Brucella suis peptidoglycan through specific detection mechanisms. Mammalian peptidoglycan recognition proteins include PGLYRP 1-4, which can detect GlcNAc-MurNAc-tetrapeptide fragments, and NOD1/NOD2 receptors, which recognize specific peptidoglycan fragments (tripeptide: L-Ala-D-Glu-DAP for NOD1) . These interactions trigger various host responses, including:

  • Enzymatic degradation through amidase or muramidase activity

  • Direct bactericidal effects

  • Activation of pro-inflammatory pathways via NF-κB signaling

  • Induction of antimicrobial peptide production

  • Phagocytosis enhancement

Brucella suis, as an obligate intracellular bacterium, faces particular selective pressures regarding its peptidoglycan, especially with respect to peptidoglycan-sampling immune surveillance mechanisms located in the cytoplasm of host cells. This has likely led to adaptations in mtgA activity and resulting peptidoglycan structure to minimize host recognition .

What expression systems are most effective for producing recombinant Brucella suis mtgA?

For recombinant expression of Brucella suis mtgA, Escherichia coli-based expression systems have proven effective when properly optimized. Based on successful approaches with other bacterial transglycosylases and the methods described for microbial transglutaminase (MTG), the following strategy can be implemented:

  • Use of fusion protein technology with solubility enhancers such as maltose-binding protein (MBP)

  • Expression in E. coli BL21(DE3) in rich media such as Terrific Broth (TB)

  • Inclusion of a tobacco etch virus (TEV) protease cleavage site for removal of fusion tags

  • Codon optimization for E. coli expression

  • Temperature optimization, typically with induction at lower temperatures (16-25°C)

When optimizing expression conditions, researchers should consider that active mtgA may exhibit toxicity to E. coli cells due to interference with the host cell's peptidoglycan synthesis, as observed with the MTG expression system where the cell wet weight was significantly reduced (4.2 ±0.1 g vs 1.0 ±0.1 g) when the enzyme was active .

What purification strategy yields the highest purity and activity of recombinant mtgA?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant mtgA:

  • Initial capture using affinity chromatography (e.g., HisTag-based nickel-nitrilotriacetic acid columns)

  • Intermediate purification using ion exchange chromatography

  • Polishing step with size-exclusion chromatography (SEC) to remove aggregates and cleaved fusion partners

This approach is supported by the successful purification of recombinant MTG, which faced similar challenges with protein-protein interactions and potential self-cross-linking . The use of SEC is particularly important for removing any cleaved propeptide or fusion tags that may remain associated with the target protein through non-covalent interactions. Monitoring of specific activity throughout the purification process is essential to ensure that the purification steps preserve enzyme functionality.

How can researchers overcome the challenges of potential toxicity when expressing recombinant mtgA?

To overcome potential toxicity issues when expressing recombinant Brucella suis mtgA in E. coli, researchers should consider the following strategies:

  • Use of tightly controlled inducible promoters (such as T7lac) to minimize leaky expression

  • Expression of mtgA as an inactive zymogen or with point mutations in catalytic residues that can be later reactivated

  • Utilization of E. coli strains with altered peptidoglycan composition that may be more resistant to mtgA activity

  • Co-expression with inhibitory propeptides or proteins that can prevent premature activity

  • Implementation of auto-induction media systems that maintain low levels of inducer until high cell density is reached

The evidence for toxicity comes from similar enzymes like MTG, where variants with catalytic activity showed significantly reduced E. coli cell mass (1.0 ±0.1 g compared to 4.2 ±0.1 g for the inactive variant) . Strategic mutations in propeptide regions (similar to the K10R and Y12A mutations used for MTG) may facilitate the dissociation of inhibitory domains and improve the yield of active enzyme.

What assays can be used to accurately measure the transglycosylase activity of recombinant B. suis mtgA?

Several complementary assays can be employed to accurately measure the transglycosylase activity of recombinant B. suis mtgA:

  • Fluorescence-based assays: Using dansyl-labeled lipid II substrates to monitor the polymerization of glycan strands, with product formation detected by changes in fluorescence intensity or anisotropy.

  • HPLC-based assays: Analyzing the products of transglycosylase reactions separated by high-performance liquid chromatography, which allows quantification of glycan chains of different lengths.

  • Coupled enzyme assays: Linking transglycosylase activity to a secondary reporter enzyme that produces a colorimetric or fluorescent signal.

  • Radioactive assays: Using radiolabeled substrates (typically with 14C or 3H) to track product formation through scintillation counting after separation.

  • In vitro peptidoglycan synthesis systems: Reconstituting the peptidoglycan synthesis pathway with purified components to assess mtgA activity in a more physiologically relevant context.

The specific activity of the enzyme should be reported in standardized units, similar to how MTG activity was measured by hydroxamate assay with results reported as specific activity (22.7 ±2.6 U/mg for the properly processed enzyme) .

How does the structure of Brucella suis mtgA compare with homologous enzymes from other bacterial species?

While the specific structure of Brucella suis mtgA has not been fully elucidated in the provided search results, comparative analysis with homologous enzymes from related species can provide valuable insights:

  • Substrate binding regions that influence specificity for lipid II variants with different stem peptide compositions

  • Regulatory domains that respond to Brucella-specific signaling pathways

  • Surface-exposed regions that may have evolved to evade host immune recognition

Brucella species have shown significant homology with other alphaproteobacteria such as Agrobacterium tumefaciens and Rhizobium meliloti in various systems, as evidenced by the BvrR-BvrS two-component regulatory system which is highly similar to ChvG-ChvI of A. tumefaciens and ExoS-ChvI of R. meliloti . This suggests that mtgA may also share structural features with the corresponding enzymes in these related bacteria.

What inhibitors are effective against B. suis mtgA and how do they compare to broad-spectrum transglycosylase inhibitors?

The development of inhibitors against B. suis mtgA represents an important research area with therapeutic potential. Effective inhibitors may include:

  • Moenomycin derivatives: These natural product analogs bind to the active site of transglycosylases and prevent substrate binding. Structure-activity relationship studies could identify derivatives with enhanced specificity for B. suis mtgA.

  • Lipid II analogs: Competitive inhibitors that mimic the natural substrate but cannot be processed by the enzyme.

  • Species-specific small molecule inhibitors: Compounds identified through high-throughput screening that may exploit unique structural features of B. suis mtgA.

The efficacy of these inhibitors against B. suis mtgA compared to broad-spectrum inhibitors would need to be evaluated through:

  • IC50/Ki determination for various inhibitors

  • Structural studies of enzyme-inhibitor complexes

  • Assessment of inhibitor effects on Brucella growth and survival in various conditions

  • Evaluation of synergy with other antibiotics

Since peptidoglycan is an essential component for bacterial survival in hypoosmolar environments and a target for multiple classes of clinically successful antibiotics like beta-lactams and glycopeptides , identifying specific inhibitors of B. suis mtgA could lead to new therapeutic approaches for brucellosis.

How does mtgA activity in B. suis biovar 1 contribute to survival within different host species?

The mtgA activity in B. suis biovar 1 contributes significantly to its survival across multiple host species through several mechanisms:

  • Adaptation to intracellular lifestyle: mtgA modulates peptidoglycan synthesis to maintain cell wall integrity within the isotonic intracellular environment while evading host detection.

  • Host-specific peptidoglycan modifications: B. suis biovar 1 may alter its peptidoglycan structure in different hosts to evade specific immune responses. This adaptability is consistent with its broad host range, affecting domestic animals and wildlife species .

  • Tissue tropism: Different levels or patterns of mtgA activity may contribute to the specific tissue tropism observed in experimental infections. For example, in armadillos, B. suis biovar 1 was isolated from multiple tissues including spleen, liver, mesenteric lymph nodes, uterus, testes, and urine .

  • Persistence mechanisms: Carefully regulated peptidoglycan metabolism may allow the bacteria to enter dormant states in certain host tissues, contributing to chronic infection.

The experimental infection of armadillos demonstrated that B. suis biovar 1 can successfully establish infection, with all inoculated animals showing positive antibody titers within 2 weeks post-inoculation . This rapid establishment of infection across diverse hosts suggests that mtgA function is robust enough to support peptidoglycan synthesis in various host environments.

What is the relationship between mtgA activity and the evasion of host immune responses?

The relationship between mtgA activity and evasion of host immune responses is complex and multifaceted:

  • Reduced immune detection: Brucella may regulate mtgA activity to minimize the release of peptidoglycan fragments that could be detected by host peptidoglycan recognition proteins. Multiple host receptors can detect these fragments, including PGLYRP 1-4, Nod1/2, and lysozyme, triggering various immune responses including NF-κB signaling and production of proinflammatory cytokines .

  • Structural modifications: mtgA may incorporate modified subunits into peptidoglycan that are less stimulatory to host immune receptors. The obligate intracellular lifestyle of Brucella has resulted in particular selective pressures on their peptidoglycan, especially with respect to peptidoglycan-sampling immune surveillance mechanisms located in the cytoplasm of host cells .

  • Temporal regulation: Brucella may temporally regulate mtgA activity during different stages of infection to minimize detection while maintaining sufficient cell wall integrity.

  • Spatial compartmentalization: mtgA activity may be regulated spatially within the bacterium to minimize the release of peptidoglycan fragments into host cell cytoplasm where they could be detected by cytoplasmic pattern recognition receptors like NOD1 and NOD2.

The ability of B. suis biovar 1 to establish infection in multiple host species and tissues, including transmission to uninoculated animals in close contact , suggests effective evasion of host immune responses partly mediated by controlled mtgA activity.

How does peptidoglycan synthesis by mtgA intersect with other virulence mechanisms in B. suis biovar 1?

Peptidoglycan synthesis by mtgA intersects with other virulence mechanisms in B. suis biovar 1 through multiple pathways:

  • Two-component regulatory systems: The BvrR-BvrS two-component regulatory system in Brucella, which is highly similar to systems in Agrobacterium tumefaciens (ChvG-ChvI) and Rhizobium meliloti (ExoS-ChvI), likely influences cell envelope properties including peptidoglycan synthesis . This system affects sensitivity to antimicrobial peptides and outer membrane properties critical for virulence.

  • Coordination with secretion systems: Proper peptidoglycan structure is necessary for the assembly and function of bacterial secretion systems that deliver virulence factors into host cells.

  • Bacterial morphology and division: mtgA activity affects cell shape and division, which may influence invasion efficiency and intracellular replication rates.

  • Anchoring of surface virulence factors: Peptidoglycan serves as an anchor for surface-exposed virulence factors, including adhesins and invasins that mediate host cell entry.

  • Stress response integration: Peptidoglycan synthesis is integrated with stress response pathways that help the bacterium adapt to the hostile host environment.

The bacA gene in B. abortus, which encodes a putative cytoplasmic membrane transport protein, shows that systems involved in bacterium-plant symbiosis could be alternative models to study Brucella pathogenesis . This suggests that mtgA activity may be coordinated with other bacterial factors originally evolved for symbiotic relationships but repurposed for pathogenesis.

How can structural information about B. suis mtgA be leveraged for rational drug design?

Structural information about B. suis mtgA can be leveraged for rational drug design through several sophisticated approaches:

  • Structure-based virtual screening: Using the three-dimensional structure of B. suis mtgA (determined through X-ray crystallography, cryo-EM, or homology modeling) to computationally screen virtual libraries of compounds for potential binders to the active site or allosteric sites.

  • Fragment-based drug discovery: Identifying small molecular fragments that bind to different sites on mtgA and subsequently linking or growing these fragments into larger, more potent inhibitors.

  • Transition-state analog design: Developing compounds that mimic the transition state of the transglycosylation reaction catalyzed by mtgA, which typically bind with higher affinity than substrate analogs.

  • Allosteric inhibitor development: Targeting non-active site regions that regulate enzyme activity, potentially offering greater selectivity for B. suis mtgA over homologous enzymes in other bacteria or host cells.

  • Structure-guided mutagenesis: Using structural information to design mutations that could reveal key functional residues and binding determinants, informing subsequent inhibitor design.

This approach is particularly promising since peptidoglycan synthesis enzymes are established antibiotic targets, with multiple classes of clinically successful antibiotics targeting various aspects of peptidoglycan synthesis .

What are the potential applications of recombinant B. suis mtgA in synthetic biology and biotechnology?

Recombinant B. suis mtgA offers several promising applications in synthetic biology and biotechnology:

  • Engineered peptidoglycan production: Creating synthetic peptidoglycan variants with novel properties for material science applications.

  • Glycan polymer synthesis: Utilizing the transglycosylase activity to produce defined glycan polymers for research or therapeutic applications.

  • Vaccine development: Using recombinant mtgA to generate peptidoglycan fragments or modified whole cells as vaccine candidates against brucellosis.

  • Diagnostic tool development: Employing recombinant mtgA in diagnostic assays to detect antibodies against Brucella or to generate specific peptidoglycan fragments as biomarkers.

  • Protein conjugation applications: Similar to microbial transglutaminase (MTG), which is used for protein modification through cross-linking reactions , engineered variants of mtgA might be developed for specific glycoconjugation reactions.

The successful production methods developed for recombinant enzymes like microbial transglutaminase, which achieved a specific activity of 22.7±2.6 U/mg after optimization , provide a valuable template for developing production systems for recombinant B. suis mtgA with high yield and activity.

How can in vivo studies of mtgA function in animal models advance our understanding of Brucella pathogenesis?

In vivo studies of mtgA function in animal models can significantly advance our understanding of Brucella pathogenesis through several approaches:

  • Conditional mutant studies: Developing conditional mtgA mutants to study the timing and tissue-specific requirements for mtgA activity during infection.

  • Chimeric enzyme studies: Creating chimeric mtgA variants combining regions from different Brucella species to identify determinants of host specificity.

  • Real-time imaging: Using fluorescent D-amino acids that incorporate into newly synthesized peptidoglycan to visualize mtgA activity during infection in real-time.

  • Transmission studies: Investigating how mtgA activity affects bacterial shedding and transmission between hosts, similar to the observed transmission to uninoculated animals in the armadillo model .

  • Host response characterization: Examining how different host species respond immunologically to wild-type versus mtgA-modified B. suis strains.

The armadillo model has already demonstrated the feasibility of such studies, showing that B. suis biovar 1 established infection in multiple tissues and could be transmitted to uninoculated animals in close contact . Similar approaches could be applied to study specifically how mtgA activity contributes to these aspects of pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.