Recombinant Brucella suis biovar 1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; BR0812; BS1330_I0808; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation, generating a proton gradient; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred.

Database Links

KEGG: bms:BR0812

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K in Brucella suis biovar 1?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of Complex I in the electron transport chain of Brucella suis biovar 1. This protein participates in cellular respiration by transferring electrons from NADH to quinone, contributing to the proton gradient necessary for ATP synthesis. In B. suis biovar 1, nuoK functions within the membrane-embedded domain of the complex, making it important for energy metabolism and potentially bacterial virulence .

The protein is encoded by the nuoK gene, which is part of the nuo operon in B. suis biovar 1. This operon contains multiple genes encoding various subunits of the NADH-quinone oxidoreductase complex. Understanding this protein is vital because energy metabolism components often represent potential targets for antimicrobial development and are frequently involved in bacterial pathogenesis mechanisms .

How does B. suis biovar 1 differ from other Brucella species and biovars?

Brucella suis biovar 1 has distinct characteristics that differentiate it from other Brucella species and biovars:

  • Host specificity: B. suis biovar 1 primarily infects domesticated pigs but has also been established in feral pigs in certain regions. It has been isolated from collared peccaries (Tayassu tajacu) as well .

  • Geographical distribution: This biovar is common in domesticated pigs in some parts of the world, particularly in Asia, and has been reported in multiple countries across different continents .

  • Pathogenicity: Biovar 1 is considered highly pathogenic for humans, potentially causing more severe disease than some other Brucella species. It leads to significant reproductive issues in swine, including abortions .

  • Phenotypic characteristics: When cultured and identified in laboratory settings, B. suis biovar 1 demonstrates specific growth patterns and biochemical characteristics that distinguish it from other biovars. It can be identified using phenotypic methods such as phage typing and cultural, biochemical, and serological characteristics .

What are the recommended isolation and culture techniques for working with B. suis biovar 1?

For effective isolation and culture of B. suis biovar 1 for nuoK studies, researchers should follow these methodological approaches:

Sample collection and processing:

  • Collect appropriate specimens based on research aims: aborted fetuses (stomach contents, spleen, lung), placenta, vaginal swabs, semen, testis, or epididymis tissues .

  • For necropsy samples, prioritize lymph nodes (especially those associated with the head, mammary gland, and genital tract), uterus, udder, and spleen .

Culture media options:

  • Non-selective media can be used for clean samples

  • Selective media options include:

    • Farrell's medium

    • Thayer-Martin's medium

    • CITA medium - prepared with blood agar base supplemented with 5% sterile calf serum and containing:

      • Vancomycin (20 mg/liter)

      • Colistin methanesulfonate (7.5 mg/liter)

      • Nitrofurantoin (10 mg/liter)

      • Nystatin (100,000 IU/liter)

      • Amphotericin B (4 mg/liter)

Important methodological considerations:

  • Use multiple media types as some isolates may not grow readily on certain formulations

  • Watch for potential bacterial overgrowth in non-sterile samples

  • Be aware that prior antibiotic treatment can interfere with culture success

  • Incubate cultures at 37°C in an atmosphere with 5-10% CO₂

What expression systems are most effective for recombinant production of B. suis biovar 1 nuoK?

When expressing recombinant B. suis biovar 1 NADH-quinone oxidoreductase subunit K, researchers should consider several expression systems with their respective advantages and limitations:

E. coli-based expression systems:

  • pET expression system: Provides high expression levels under T7 promoter control, allowing for tight regulation of protein expression. This system is particularly useful for initial characterization studies of nuoK.

  • pBAD system: Offers arabinose-inducible expression with finer control over expression levels, which may be beneficial for membrane proteins like nuoK that can be toxic when overexpressed.

Other potential expression hosts:

  • Yeast expression systems: Pichia pastoris can be valuable for membrane protein expression, providing a eukaryotic processing environment while maintaining relatively high yields.

  • Cell-free expression systems: These may overcome toxicity issues associated with membrane protein expression in living cells.

Methodological considerations:

  • Include affinity tags (His6, FLAG, etc.) at either N- or C-terminus for purification, with TEV protease cleavage sites for tag removal

  • Optimize codon usage for the selected expression host

  • Consider fusion partners (MBP, SUMO, etc.) to enhance solubility

  • For membrane proteins like nuoK, detergent screening is critical during purification

The selection of an appropriate expression system should be guided by the specific research objectives and downstream applications of the recombinant protein.

How does nuoK contribute to B. suis biovar 1 virulence and pathogenicity?

The NADH-quinone oxidoreductase subunit K likely contributes to B. suis biovar 1 virulence through several interconnected mechanisms:

Metabolic adaptation during infection:

  • NuoK, as part of Complex I, plays a crucial role in bacterial energy metabolism, potentially allowing B. suis biovar 1 to adapt to the nutrient-limited environment within host cells.

  • The ability to maintain ATP production under varying conditions would support bacterial survival during different stages of infection.

Intracellular survival mechanisms:

  • Brucella species are known to survive within macrophages, which represents a key virulence trait. Proper energy metabolism supported by functional nuoK may be essential for this intracellular lifestyle.

  • Metabolic functions may influence the bacteria's ability to evade host immune responses by modifying local microenvironments.

Potential roles in stress response:

  • Respiratory chain components often contribute to bacterial responses to oxidative stress, which bacteria encounter within host cells.

  • Mutation studies in related bacterial systems suggest that disruption of respiratory chain components can attenuate virulence.

Understanding these connections requires comparative studies between wild-type strains and nuoK mutants, evaluating parameters such as:

  • Intracellular survival rates

  • Virulence in animal models

  • Metabolic profiles under various conditions

  • Resistance to oxidative stress challenges

What structural modifications of recombinant nuoK affect its functional properties?

Structural modifications of recombinant B. suis biovar 1 nuoK can significantly impact its functional properties in experimental settings:

Critical structural elements affecting function:

  • Transmembrane domains: NuoK contains multiple transmembrane regions that anchor it within the membrane. Modifications to these regions can disrupt proper membrane insertion and complex assembly.

  • Conserved residues: Certain amino acids in nuoK are highly conserved across bacterial species, suggesting functional importance:

    • Charged residues facing the membrane may participate in proton translocation

    • Residues at subunit interfaces are crucial for Complex I assembly

  • Post-translational modifications: While bacterial proteins generally have fewer modifications than eukaryotic proteins, any native modifications in nuoK would be essential to maintain in recombinant systems.

Experimental approaches to study structure-function relationships:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.