Recombinant Brucella suis biovar 1 Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Brucella suis Biology and Pathogenesis

Brucella suis is a Gram-negative, facultative intracellular bacterium belonging to the class Alphaproteobacteria. It is recognized as a causative agent of brucellosis, a significant zoonotic disease transmitted from animals to humans . B. suis is characterized morphologically as small, nonencapsulated, nonmotile, facultatively intracellular coccobacilli that primarily infect domestic and wild ungulates . The pathogen can be transmitted through various routes, including ingestion of contaminated food, direct contact with infected animals, or inhalation of aerosols, making it a considerable public health concern .

B. suis biovar 1 strain 1330 holds particular significance in Brucella research as it has been extensively studied, re-sequenced, and serves as a reference strain with one of the largest Brucella genomes . The complete genome of B. suis comprises two chromosomes with a total genome size of approximately 3.3 Mbp and contains more than 3,225 genes per genome . The first chromosome (chr1) ranges from 1,927,848 to 1,927,959 bp with a G+C content of 57.12%, while the second chromosome (chr2) spans from 1,401,398 bp to 1,401,514 bp with a G+C content of 57.33% .

Genomic Organization and Expression Regulation

The genomic architecture of B. suis is characterized by a sophisticated regulatory network that orchestrates gene expression in response to environmental stimuli. Central to this regulatory framework are two-component systems (TCSs) that enable the bacterium to sense and respond to environmental changes . One such critical system is the BvrR/BvrS TCS, which plays an essential role in regulating genes involved in cell envelope homeostasis, nucleotide synthesis, and virulence factors .

The genomic context of the cdsA gene in B. suis biovar 1 places it at a metabolic crossroads, potentially regulated by these response systems. The cdsA gene, encoding Phosphatidate cytidylyltransferase, likely falls under the influence of regulatory mechanisms that modulate phospholipid biosynthesis pathways, which have been identified as significantly enriched in BvrR binding sites under stress conditions . The table below summarizes the key genomic features of B. suis biovar 1:

FeatureChromosome 1Chromosome 2Total
Size (bp)~1,927,900~1,401,450~3,329,350
G+C content (%)57.1257.3357.21 (avg)
Protein-coding genes-->3,225
tRNAs--54
rRNA operons--3
Transfer-messenger RNA--1

Enzyme Function and Catalytic Mechanism

Phosphatidate cytidylyltransferase, encoded by the cdsA gene, catalyzes a critical step in phospholipid biosynthesis—the conversion of phosphatidic acid (PA) to cytidine diphosphate-diacylglycerol (CDP-DAG) . This reaction represents a crucial metabolic junction in the bacterial cell membrane biosynthetic pathway. The enzyme utilizes cytidine triphosphate (CTP) as a substrate along with PA to generate CDP-DAG and pyrophosphate.

The catalytic mechanism involves nucleophilic attack of the phosphate group of PA on the α-phosphate of CTP, resulting in the displacement of pyrophosphate and the formation of a phosphodiester linkage. This reaction is fundamental for the subsequent synthesis of various phospholipids, including phosphatidylinositol, phosphatidylglycerol, and cardiolipin, which are essential components of bacterial cell membranes.

Substrate Specificity and Kinetic Properties

While specific information about B. suis cdsA is limited in the available research, insights can be drawn from studies on homologous enzymes, particularly the human CDP-diacylglycerol synthases (CDS1 and CDS2), which perform analogous functions. In human systems, these isoforms display distinct substrate specificities, with CDS1 showing broad substrate acceptance and CDS2 exhibiting selective preference for specific acyl chain compositions .

Research on human CDS enzymes has revealed that CDS2 demonstrates a marked preference for 1-stearoyl-2-arachidonoyl-sn-phosphatidic acid (SAPA), while CDS1 exhibits comparable activity across various PA species . This differential selectivity suggests a possible evolutionary mechanism to generate distinct CDP-DAG pools with specific acyl chain compositions, potentially serving diverse phospholipid synthesis pathways.

The kinetic parameters determined for human CDS enzymes provide a reference point for understanding potential properties of bacterial cdsA. For instance, human CDS1 shows Vmax values of approximately 3.3 ± 0.3 and 3.6 ± 0.1 μmol of CDP-DAG min⁻¹mg⁻¹ for SAPA and SLPA (1-stearoyl-2-linoleoyl-sn-phosphatidic acid), respectively . These values may serve as comparative benchmarks when characterizing the bacterial enzyme.

Expression Systems and Purification Strategies

Recombinant production of B. suis biovar 1 Phosphatidate cytidylyltransferase likely employs expression systems similar to those used for other Brucella proteins. Based on practices observed with other recombinant Brucella proteins, expression hosts such as E. coli, yeast, baculovirus, or mammalian cell systems may be utilized . The choice of expression system significantly impacts protein yield, folding, and post-translational modifications, all crucial factors for obtaining functionally active enzyme.

Purification strategies for recombinant cdsA would typically involve affinity chromatography, leveraging fusion tags such as poly-histidine or glutathione S-transferase. Subsequent purification steps might include ion exchange chromatography and size exclusion chromatography to achieve high purity necessary for enzymatic and structural studies.

Contribution to Membrane Biogenesis and Cell Viability

The cdsA enzyme occupies a pivotal position in B. suis metabolism, specifically in phospholipid biosynthesis pathways that are essential for bacterial membrane structure and function. The production of CDP-DAG serves as a precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and ultimately cardiolipin, which collectively contribute to membrane integrity, fluidity, and functionality .

The significance of phospholipid biosynthesis in Brucella is underscored by transcriptomic and proteomic analyses revealing that genes involved in this pathway are regulated by the BvrR/BvrS two-component system, which is essential for Brucella virulence . This regulatory connection suggests that cdsA expression may be modulated during infection to adapt membrane composition to the intracellular environment.

Potential Implications for Virulence and Host Interaction

While direct evidence linking cdsA to Brucella virulence is not explicitly stated in the available research, the enzyme's role in membrane biosynthesis suggests potential implications for pathogenesis. Proper membrane composition is crucial for Brucella's ability to resist host defense mechanisms, including resistance to antimicrobial peptides and adaptation to acidic environments encountered within host cells.

The cell envelope of Brucella represents a critical interface for host-pathogen interactions, and its composition directly impacts virulence factors such as the VirB secretion system, which is essential for intracellular replication . The regulation of phospholipid biosynthesis genes, including potentially cdsA, by virulence-associated regulatory systems suggests an integrated role in the pathogen's virulence strategy.

Conservation Across Brucella Species

Genomic analyses suggest high conservation of essential metabolic genes across Brucella species, with core genome phylogeny indicating distinct clustering patterns among strains . While specific comparative analyses of cdsA are not detailed in the available research, the enzyme likely shows high sequence conservation across Brucella species given its fundamental role in phospholipid biosynthesis.

Multilocus sequence typing (MLST) and whole genome phylogeny approaches have revealed evolutionary relationships among Brucella isolates, with most Indian B. melitensis strains, for example, clustering in the East Mediterranean lineage . Such phylogenetic patterns may extend to the conservation and evolutionary trajectory of the cdsA gene across the genus.

Functional Divergence from Human Homologs

Understanding the differences between bacterial cdsA and human CDS enzymes is crucial for exploring the protein's potential as a therapeutic target. Human cells express two CDP-diacylglycerol synthase isoforms (CDS1 and CDS2) that catalyze the same reaction but exhibit different substrate specificities .

A key distinction lies in their substrate preferences: human CDS2 shows selective preference for specific acyl chain compositions, particularly favoring 1-stearoyl-2-arachidonoyl-sn-phosphatidic acid, while CDS1 displays broad substrate acceptance . The bacterial cdsA may have evolved distinct substrate specificities optimized for bacterial membrane composition, potentially creating exploitable differences for therapeutic intervention.

Potential as a Drug Target

The essential role of cdsA in bacterial phospholipid biosynthesis, coupled with potential structural and functional differences from human homologs, positions it as a promising target for antimicrobial development. Inhibitors specifically targeting the bacterial enzyme could potentially disrupt membrane formation, compromising bacterial viability without affecting host enzymes.

The challenge in developing such inhibitors lies in achieving selectivity for the bacterial enzyme over human CDS isoforms. Understanding the structural and biochemical differences between these enzymes would be crucial for rational drug design approaches targeting B. suis cdsA.

Applications in Vaccine Development

Recombinant B. suis proteins, including potentially cdsA, hold promise for vaccine development strategies. The protein could serve as an antigen in subunit vaccine formulations, stimulating protective immune responses without the risks associated with live attenuated vaccines .

Additionally, understanding the role of cdsA in membrane biosynthesis could inform the development of attenuated Brucella strains with modified membrane composition, potentially creating candidates for live attenuated vaccines with reduced virulence but preserved immunogenicity.

Systems Biology Approaches

Understanding the regulatory networks controlling cdsA expression, especially in response to environmental stressors encountered during infection, would provide insights into how Brucella adapts its membrane composition during pathogenesis. This knowledge could reveal additional vulnerabilities in the pathogen's life cycle that could be targeted therapeutically.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; BR1157; BS1330_I1153; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
cdsA
Target Protein Sequence
MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDIAAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVPSAIFFSF
Uniprot No.

Target Background

Database Links

KEGG: bms:BR1157

Protein Families
CDS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does cdsA expression change during Brucella infection and what methodologies best capture these dynamics?

The expression of cdsA shows significant upregulation during long-term Brucella infection compared to in vitro culture conditions. Research has identified cdsA among the genes highly expressed in Brucella recovered from goat lymph nodes after 38 weeks of infection, while showing comparatively low expression in acidified in vitro cultures . This differential expression suggests a critical role in persistent infection.

Methodological approaches to study cdsA expression dynamics include:

  • Coincidence Cloning Technique: This approach enables recovery and characterization of Brucella RNA from in vivo infection sites, overcoming challenges associated with the overwhelming abundance of host RNA .

  • RNA-Seq Analysis Pipeline:

    • RNA extraction from infected tissues using TRIzol-based methods

    • Host RNA depletion using commercial kits or coincidence cloning

    • Library preparation optimized for bacterial transcripts

    • Normalization to gene length (RPKM values) for accurate quantification

    • Comparison to reference datasets from various growth conditions

  • Quantitative RT-PCR: For targeted validation of expression changes using gene-specific primers.

  • In vivo Expression Technology (IVET): To identify genes specifically activated during infection.

When analyzing expression data, it's critical to normalize properly and consider the growth phase of comparison samples to avoid misinterpreting results that might simply reflect growth phase differences rather than host adaptation .

  • What is the relationship between cdsA function and Brucella persistence in host tissues?

The cdsA gene has been identified as a candidate of interest in persistent Brucella infections based on its high expression in long-term lymph node infections compared to in vitro conditions . Its function in phospholipid biosynthesis appears particularly important in the context of bacterial adaptation to the host environment.

Several lines of evidence suggest cdsA's role in persistence:

  • Long-term infected samples exhibit elevated expression of genes involved in lipid metabolism, including cdsA .

  • The enzyme's role in synthesizing phospholipid precursors may be critical for membrane remodeling during adaptation to nutrient-limited or hypoxic host environments.

  • The gene does not appear to be significantly influenced by growth phase in culture, suggesting that its differential expression in host tissues represents a specific adaptation rather than a growth state effect .

To investigate cdsA's role in persistence experimentally, researchers should consider:

  • Constructing conditional mutants with regulated cdsA expression

  • Performing comparative lipidomic analyses of wild-type and cdsA-attenuated strains

  • Evaluating bacterial survival in macrophage and animal models using cdsA mutants

  • Analyzing membrane properties and stress resistance in relation to cdsA expression levels

  • How can researchers effectively study the immunogenic properties of recombinant cdsA?

Based on approaches used for other Brucella antigens such as Omp31, several methodological strategies can be applied to study the immunogenic properties of recombinant cdsA:

  • Recombinant Protein Preparation:

    • Expression of cdsA in heterologous systems with appropriate tags

    • Purification using affinity chromatography

    • Confirmation of purity by SDS-PAGE and Western blotting

    • Endotoxin removal for immunization studies

  • Immunization Protocols:

    • Administration with appropriate adjuvants (e.g., incomplete Freund's adjuvant)

    • Multiple immunization schedules (primary + boosters)

    • Varying routes of administration (subcutaneous, intraperitoneal)

  • Immune Response Analysis:

    • Measurement of antibody responses using ELISA (IgG, IgG1, IgG2 titers)

    • In vitro stimulation of splenocytes from immunized animals

    • Cytokine profiling (IL-2, IFN-γ, IL-10, IL-4) to determine T helper bias

    • Flow cytometry to assess T-cell subset activation

  • Protection Studies:

    • Challenge with virulent Brucella strains

    • Bacterial load determination in target organs (spleen, liver)

    • In vivo T-cell subset depletion to determine protective mechanisms

    • Cytotoxic T-lymphocyte activity assessment against Brucella-infected macrophages

These methodologies, adapted from successful studies with other Brucella antigens, provide a framework for evaluating both the immunogenicity and potential protective efficacy of recombinant cdsA.

  • What bioinformatic approaches can identify functional domains and evolutionary relationships of cdsA?

Comprehensive bioinformatic analysis of cdsA requires multiple computational approaches:

  • Sequence Analysis:

    • Multiple sequence alignment of cdsA across Brucella species and other alpha-proteobacteria

    • Identification of conserved motifs using MEME, GLAM2, or similar tools

    • Transmembrane domain prediction using TMHMM or Phobius

    • Signal peptide prediction using SignalP

  • Structural Analysis:

    • Secondary structure prediction using PSIPRED or JPred

    • Tertiary structure modeling using I-TASSER or AlphaFold

    • Active site prediction based on structural homology

    • Molecular docking simulations with substrate molecules

  • Comparative Genomics:

    • Synteny analysis to identify conserved gene neighborhoods

    • Identification of regulatory elements in promoter regions

    • Codon usage analysis to detect selective pressures

    • Phylogenetic analysis to trace evolutionary history

  • Functional Prediction:

    • Protein-protein interaction network modeling

    • Pathway integration analysis

    • Gene ontology enrichment assessment

    • Prediction of post-translational modifications

These approaches can reveal functional constraints on cdsA evolution and identify potential interaction partners within bacterial metabolic networks.

  • How does oxygen availability affect cdsA expression and function in Brucella suis?

While the search results don't directly address cdsA regulation by oxygen, research on oxygen-dependent establishment of Brucella persistence provides relevant context. The two-component system RegB/A plays a key role in oxygen-dependent adaptation in Brucella suis , and understanding whether cdsA falls under this regulatory network is important.

To investigate oxygen effects on cdsA:

  • Transcriptomic Analysis:

    • Compare cdsA expression in wild-type vs. ΔregA mutants under various oxygen conditions

    • Utilize microarray or RNA-seq approaches as demonstrated in RegA studies

    • Apply significance analysis of microarrays (SAM) tool with appropriate statistical thresholds (fold change ≥2, FDR ≤5%)

  • Promoter Analysis:

    • Identify potential RegA binding sites in the cdsA promoter region

    • Perform electrophoretic mobility shift assays to confirm direct regulation

    • Construct reporter fusions to quantify transcriptional activity under varying oxygen tensions

  • Metabolic Impact Assessment:

    • Measure phospholipid composition changes under aerobic vs. microaerobic conditions

    • Assess membrane properties in relation to oxygen availability

    • Evaluate the functional consequences of oxygen-dependent regulation on bacterial persistence

This integrated approach can reveal whether cdsA regulation contributes to oxygen-dependent adaptation mechanisms in Brucella suis.

  • What experimental approaches can determine the structure-function relationship of cdsA in Brucella suis?

Understanding structure-function relationships of cdsA requires integrated biochemical and genetic approaches:

  • Protein Purification and Characterization:

    • Optimization of expression conditions for recombinant cdsA

    • Purification strategies for membrane-associated proteins (detergent selection)

    • Circular dichroism spectroscopy for secondary structure assessment

    • Size exclusion chromatography to determine oligomeric state

  • Enzymatic Activity Assays:

    • Development of spectrophotometric or radiometric assays for cdsA activity

    • Determination of kinetic parameters (Km, Vmax) for natural substrates

    • Inhibitor screening and characterization

    • Effect of pH, temperature, and ionic conditions on activity

  • Structural Biology:

    • X-ray crystallography of purified cdsA (challenging for membrane proteins)

    • Cryo-electron microscopy as an alternative approach

    • NMR spectroscopy for dynamic regions and substrate interactions

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Mutagenesis Studies:

    • Alanine scanning of conserved residues

    • Domain swapping with homologous enzymes

    • Creation of chimeric proteins to map functional regions

    • Complementation assays in cdsA-deficient strains to assess functionality

These approaches can provide comprehensive insights into how cdsA structure relates to its function in phospholipid biosynthesis and bacterial persistence.

  • What methodologies are appropriate for studying cdsA's role in Brucella pathogenesis versus general metabolism?

Distinguishing between cdsA's roles in basic metabolism versus specific pathogenesis mechanisms requires sophisticated experimental approaches:

  • Conditional Mutant Construction:

    • Development of inducible or repressible cdsA expression systems

    • Tetracycline-responsive or similar regulatable promoters

    • Temperature-sensitive alleles for temporal control

    • Partial activity mutants to separate lethal from attenuating effects

  • In vitro Phenotypic Characterization:

    • Growth curve analysis under various stress conditions

    • Membrane integrity assessment using fluorescent dyes

    • Resistance to host antimicrobial factors

    • Metabolomic profiling under infection-relevant conditions

  • Cellular Infection Models:

    • Macrophage infection assays with wild-type and cdsA-modified strains

    • Intracellular trafficking studies using fluorescent microscopy

    • Host cell response assessment (cytokine profiles, activation markers)

    • Real-time monitoring of bacterial replication in cell culture

  • In vivo Studies:

    • Animal infection models with tissue-specific bacterial enumeration

    • In vivo expression analysis using reporter systems

    • Competitive index assays between wild-type and mutant strains

    • Immunological parameters assessment to identify virulence-specific effects

These methodologies can help delineate whether cdsA primarily supports basic metabolic functions or specifically contributes to virulence mechanisms during host interaction.

  • What are the technical challenges in producing and purifying functional recombinant cdsA for structural studies?

Phosphatidate cytidylyltransferase (cdsA) presents several technical challenges for recombinant production due to its membrane-associated nature:

  • Expression Optimization:

    • Selection of appropriate expression systems (bacterial vs. eukaryotic)

    • Codon optimization for the chosen expression host

    • Fusion tag selection (His, GST, MBP) to improve solubility

    • Induction parameters (temperature, inducer concentration, duration)

  • Solubilization Strategies:

    • Detergent screening (non-ionic, zwitterionic, ionic)

    • Lipid nanodiscs or amphipols as membrane mimetics

    • Bicelle formulations for maintaining native-like environment

    • Addition of specific phospholipids to stabilize protein conformation

  • Purification Challenges:

    • Multi-step purification protocols (affinity, ion exchange, size exclusion)

    • Detergent exchange during purification

    • Prevention of protein aggregation

    • Removal of contaminants without compromising activity

  • Activity Preservation:

    • Buffer optimization for long-term stability

    • Cryoprotectant addition for storage

    • Activity assays to confirm functional state

    • Reconstitution into liposomes for functional studies

Addressing these challenges requires iterative optimization and combination of multiple approaches to obtain functionally active recombinant cdsA suitable for structural and biochemical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.