Recombinant Brucella suis biovar 1 Probable ABC transporter permease protein BRA1188/BS1330_II1179 (BRA1188, BS1330_II1179)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipment is required, please communicate your needs in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
BRA1188; BS1330_II1179; Probable ABC transporter permease protein BRA1188/BS1330_II1179
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
BRA1188
Target Protein Sequence
MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASL RRVLSGFVLGVALAIPVGFLMGWYRIARSPIEPWVQFFRMIPPLAVIPLAIVTLGIDESP KIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVR IGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAAD RRLTQWQERA
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex. It is believed to play a role in the transmembrane translocation of substrates.
Database Links

KEGG: bms:BRA1188

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the BRA1188/BS1330_II1179 ABC transporter permease protein in Brucella suis biovar 1?

The BRA1188/BS1330_II1179 is a probable ABC transporter permease protein in Brucella suis biovar 1 that functions as an integral component of the bacterial membrane transport system. ABC transporters typically consist of two transmembrane domains (formed by permease proteins like BRA1188) and two nucleotide-binding domains. In B. suis, this specific permease protein likely facilitates the translocation of substrates across the bacterial membrane, which may include nutrients, antimicrobial compounds, or virulence factors essential for bacterial survival within host cells . The protein's precise substrate specificity remains under investigation, but based on homology with other bacterial ABC transporters, it potentially plays roles in nutrient acquisition, antibiotic resistance, or virulence factor secretion that contribute to the pathogenicity of B. suis .

How is Brucella suis biovar 1 classified taxonomically, and what distinguishes it from other Brucella species?

Brucella suis biovar 1 belongs to the genus Brucella within the family Brucellaceae. B. suis is one of the six recognized Brucella species, alongside B. abortus, B. melitensis, B. canis, B. ovis, and B. neotomae . B. suis biovar 1 is specifically distinguished through multiplex PCR typing methods such as Bruce-ladder PCR and Suis-ladder PCR, which identify characteristic genetic markers . What separates B. suis from other Brucella species includes its primary host reservoir (primarily pigs for B. suis, while other species primarily infect different animals), genetic variations in outer membrane proteins, and differences in metabolic capabilities . B. suis biovar 1 is notable for being highly pathogenic to humans, forming smooth, grayish colonies approximately 0.5 mm in diameter after 48 hours of incubation, and exhibiting positive reactions for catalase and cytochrome oxidase while testing negative for indole production .

What protocols are recommended for the initial cloning of the BRA1188/BS1330_II1179 gene from Brucella suis genomic DNA?

For cloning the BRA1188/BS1330_II1179 gene from Brucella suis genomic DNA, researchers should follow a systematic approach similar to that used for other B. suis outer membrane proteins . The recommended protocol involves:

  • Primer design: Design specific primers based on the published genomic sequence of B. suis biovar 1 available in genome databases (NCBI accession numbers vary by strain, reference the Brucella genome database for specific strain information) .

  • PCR amplification: Amplify the full-length open reading frame (ORF) using high-fidelity DNA polymerase to minimize mutation introduction .

  • Directional cloning: Insert the PCR product into an entry vector such as pENTR directional TOPO vector, which facilitates downstream recombination into expression vectors .

  • Transformation and selection: Transform the construct into E. coli TOP10 cells and select transformants on media containing appropriate antibiotics (e.g., 50 μg/ml kanamycin for the entry vector) .

  • Verification: Confirm correct insertion and sequence integrity through restriction digestion analysis and DNA sequencing to ensure the cloned gene matches the reference sequence in the genome database .

What expression systems are most effective for recombinant production of the BRA1188/BS1330_II1179 permease protein?

The expression of recombinant BRA1188/BS1330_II1179 permease protein presents challenges due to its membrane-embedded nature. Based on successful approaches with other Brucella outer membrane proteins, the Gateway expression system has demonstrated significant advantages for membrane protein expression . The recommended methodological approach includes:

  • Gateway recombination: After initial cloning into an entry vector, recombine the validated construct into a destination vector such as pET-DEST42, which provides C-terminal 6-His and V5 epitope tags for detection and purification .

  • Expression host selection: Transform the expression construct into E. coli BL21(DE3) cells, which are deficient in certain proteases and optimized for high-level protein expression .

  • Induction optimization: Optimize IPTG concentration (typically 0.5-1.0 mM), induction temperature (16-30°C), and duration (4-16 hours) to maximize soluble protein yield while minimizing inclusion body formation .

  • Membrane fraction isolation: Harvest cells, lyse using methods such as sonication or French press, and isolate membrane fractions through differential centrifugation to separate the membrane-associated permease protein from cytoplasmic contents .

  • Detergent solubilization: Carefully select appropriate detergents (such as n-dodecyl-β-D-maltoside or CHAPS) for membrane protein solubilization without compromising protein structure or function .

What are the critical considerations for purifying functional BRA1188/BS1330_II1179 protein for structural and biochemical studies?

Purification of functional BRA1188/BS1330_II1179 requires careful attention to maintaining protein stability and native conformation. The methodological approach should include:

  • Affinity chromatography: Utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA or HisGrab plates to capture the 6-His-tagged recombinant protein under conditions that preserve structural integrity .

  • Detergent management: Maintain appropriate detergent concentrations throughout purification steps to keep the membrane protein solubilized while preventing aggregation or denaturation .

  • Buffer optimization: Identify buffer conditions (pH, ionic strength, stabilizing additives) that maximize protein stability through systematic screening approaches .

  • Quality assessment: Verify protein purity using SDS-PAGE and Western blot analysis with anti-His antibodies or other appropriate detection methods .

  • Functional validation: Assess protein functionality through substrate binding assays, ATPase activity measurements (for associated nucleotide-binding domains), or reconstitution into artificial membrane systems to confirm that the purified protein retains its native conformational properties .

How can researchers troubleshoot poor expression yields of recombinant BRA1188/BS1330_II1179 protein?

When encountering poor expression yields of the recombinant BRA1188/BS1330_II1179 protein, researchers should implement a systematic troubleshooting approach:

  • Codon optimization: Analyze the coding sequence for rare codons in the expression host and consider synthesizing a codon-optimized gene to enhance translation efficiency .

  • Expression vector alternatives: If the pET system yields insufficient protein, evaluate alternative expression vectors with different promoters, fusion partners, or secretion signals that might improve membrane protein expression .

  • Host strain variation: Test multiple E. coli strains specialized for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), which are engineered to tolerate membrane protein overexpression .

  • Growth conditions modification: Systematically vary growth parameters including temperature (typically lowering to 16-20°C), media composition (such as using terrific broth or auto-induction media), and cell density at induction time to optimize protein folding and membrane insertion .

  • Fusion tag strategies: Consider N-terminal fusions with solubility-enhancing partners like MBP (maltose-binding protein) or SUMO, which can improve folding while remaining compatible with downstream structural or functional studies after tag removal .

What structural features distinguish the BRA1188/BS1330_II1179 permease protein from other ABC transporter components in pathogenic bacteria?

The BRA1188/BS1330_II1179 permease protein possesses several structural features that distinguish it from other bacterial ABC transporter components. While definitive structural data for this specific protein is limited, comparative analysis with homologous proteins suggests:

  • Transmembrane topology: The BRA1188/BS1330_II1179 protein likely contains multiple transmembrane alpha-helical segments (typically 6-10) that span the bacterial membrane, with specific arrangements that define its substrate specificity and transport mechanism .

  • Coupling helices: The protein contains intracellular coupling helices that interact with the nucleotide-binding domains of the ABC transporter complex, facilitating the communication between ATP hydrolysis and conformational changes required for substrate translocation .

  • Substrate-binding pocket: The arrangement of the transmembrane helices creates a specific binding pocket with amino acid residues that determine the nature and specificity of transported substrates, which may include nutrients or compounds important for B. suis virulence .

  • Species-specific variations: Comparative genomic analysis reveals sequence variations in specific regions of the permease protein that may contribute to the host specificity and pathogenicity differences observed between Brucella suis and other Brucella species .

What laboratory methods can effectively determine the substrate specificity of the BRA1188/BS1330_II1179 permease protein?

Determining the substrate specificity of the BRA1188/BS1330_II1179 permease protein requires a multi-faceted experimental approach:

  • In vitro transport assays: Reconstitute the purified permease protein along with its cognate nucleotide-binding domain partner into proteoliposomes and measure the ATP-dependent uptake or efflux of radiolabeled or fluorescently labeled potential substrates .

  • Substrate binding studies: Perform direct binding assays using techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to measure the affinity and specificity of potential substrates to the purified protein .

  • Competitive inhibition analysis: Evaluate the ability of unlabeled compounds to compete with known transported substrates, providing insights into the specificity and structural requirements for substrate recognition .

  • Mutagenesis of predicted binding site residues: Conduct site-directed mutagenesis of amino acids predicted to be involved in substrate binding, followed by functional assays to validate their role in substrate specificity .

  • Computational prediction and validation: Use homology modeling and molecular docking to predict potential substrates based on structural similarity with characterized ABC transporters, then validate these predictions experimentally .

How does the function of BRA1188/BS1330_II1179 contribute to Brucella suis virulence and pathogenesis?

The contribution of BRA1188/BS1330_II1179 to Brucella suis virulence and pathogenesis can be assessed through multiple experimental approaches:

  • Gene knockout studies: Generate deletion mutants lacking the BRA1188/BS1330_II1179 gene and assess their ability to establish infection, survive within host cells, and cause disease in cellular and animal models compared to wild-type strains .

  • Expression analysis under infection-relevant conditions: Measure the expression levels of BRA1188/BS1330_II1179 under conditions mimicking the host environment (low pH, nutrient limitation, oxidative stress) to identify potential regulation patterns associated with virulence .

  • Intracellular survival assays: Evaluate the impact of BRA1188/BS1330_II1179 mutation on B. suis survival within macrophages or other relevant host cells, which is a critical determinant of Brucella pathogenicity .

  • Nutrient acquisition analysis: Determine whether BRA1188/BS1330_II1179 functions in importing essential nutrients from the host environment that support bacterial growth and persistence during infection .

  • Drug efflux capabilities: Assess whether the transporter contributes to antimicrobial resistance by extruding antibiotics, which would impact both pathogenesis and treatment efficacy for brucellosis .

How can researchers evaluate the immunogenicity of recombinant BRA1188/BS1330_II1179 protein for vaccine development?

Evaluating the immunogenicity of recombinant BRA1188/BS1330_II1179 protein for vaccine development requires a comprehensive approach:

  • Animal immunization studies: Immunize mice, rabbits, or other appropriate animal models with purified recombinant BRA1188/BS1330_II1179 protein using suitable adjuvants, then collect serum for antibody analysis .

  • Antibody response characterization: Quantify and characterize the antibody response using enzyme-linked immunosorbent assays (ELISA), Western blotting, and neutralization assays to determine antibody titers, isotypes, and functional capacity .

  • T-cell response analysis: Evaluate cell-mediated immunity by measuring antigen-specific T-cell proliferation, cytokine production profiles (particularly IFN-γ), and CD4+/CD8+ T-cell activation in response to the recombinant protein .

  • Epitope mapping: Identify B-cell and T-cell epitopes within the BRA1188/BS1330_II1179 protein using epitope prediction algorithms, peptide arrays, and experimental validation to understand which regions contribute most significantly to protective immunity .

  • Challenge studies: Conduct protective efficacy studies by challenging immunized animals with virulent B. suis to assess survival rates, bacterial burden in tissues, and other clinically relevant parameters compared to control groups .

What experimental designs can determine if antibodies against BRA1188/BS1330_II1179 confer protection against Brucella suis infection?

To determine if antibodies against BRA1188/BS1330_II1179 confer protection against Brucella suis infection, researchers should implement the following experimental designs:

  • Passive immunization studies: Transfer purified anti-BRA1188/BS1330_II1179 antibodies (from immunized animals or monoclonal antibody production) to naive animals before challenge with virulent B. suis, then assess protection compared to control antibodies .

  • Opsonophagocytosis assays: Evaluate whether anti-BRA1188/BS1330_II1179 antibodies enhance phagocytosis and killing of B. suis by macrophages or neutrophils in vitro, which is a potential mechanism of protection .

  • Complement-mediated killing: Assess the ability of antibodies to mediate complement-dependent bactericidal activity against B. suis, which may contribute to clearance of extracellular bacteria .

  • Neutralization of protein function: Determine if antibodies can bind to BRA1188/BS1330_II1179 on the bacterial surface and inhibit its transport function, potentially reducing bacterial fitness or virulence .

  • Antibody isotype analysis: Compare the protective efficacy of different antibody isotypes (IgG1, IgG2a, IgG2b, IgG3) to understand which type of humoral response most effectively controls B. suis infection .

How does the antigenicity of BRA1188/BS1330_II1179 compare with other outer membrane proteins of Brucella suis for diagnostic applications?

The comparative antigenicity of BRA1188/BS1330_II1179 versus other outer membrane proteins (OMPs) of Brucella suis for diagnostic applications can be systematically assessed through:

  • Serological screening panels: Test purified recombinant BRA1188/BS1330_II1179 alongside other Brucella OMPs against serum samples from confirmed brucellosis patients, suspected cases, and healthy controls to determine sensitivity, specificity, and cross-reactivity profiles .

  • Time-course antibody response analysis: Evaluate antibody responses to BRA1188/BS1330_II1179 and other OMPs at different stages of infection (acute, chronic, convalescent) to identify which antigens provide the earliest or most persistent diagnostic signals .

  • Species specificity assessment: Compare the reactivity of BRA1188/BS1330_II1179 with sera from patients infected with different Brucella species to determine its utility in species-specific diagnosis .

  • Cross-reactivity evaluation: Test for potential cross-reactivity with sera from patients infected with phylogenetically related pathogens or those causing similar clinical presentations to assess diagnostic specificity .

  • Multiplexed antigen arrays: Develop protein microarrays or multiplex bead-based assays incorporating BRA1188/BS1330_II1179 and other Brucella antigens to determine optimal antigen combinations for improved diagnostic accuracy .

What genetic engineering approaches can optimize the expression and functionality of recombinant BRA1188/BS1330_II1179 for structural studies?

Optimizing recombinant BRA1188/BS1330_II1179 for structural studies requires sophisticated genetic engineering approaches:

  • Truncation and fusion strategies: Generate a series of constructs with systematic truncations or modifications of terminal regions while maintaining core functional domains, potentially improving stability and crystallization properties .

  • Thermostabilizing mutations: Introduce point mutations at positions identified through sequence alignment with thermostable homologs or through computational prediction algorithms to enhance protein stability without compromising function .

  • Disulfide engineering: Strategically introduce cysteine pairs to form stabilizing disulfide bonds that lock the protein in specific conformations, facilitating structural studies of distinct functional states .

  • Fusion with crystallization chaperones: Create fusion constructs with proteins known to facilitate crystallization, such as T4 lysozyme, BRIL (apocytochrome b562RIL), or various antibody fragments, inserted at non-critical loops in the permease structure .

  • Surface entropy reduction: Identify surface patches with high conformational entropy (typically clusters of lysine and glutamate residues) and mutate them to alanines to potentially improve crystal contacts and quality .

How can researchers differentiate between the functions of BRA1188/BS1330_II1179 and other ABC transporter permease proteins in Brucella suis?

Differentiating the specific functions of BRA1188/BS1330_II1179 from other ABC transporter permease proteins in Brucella suis requires comprehensive comparative analyses:

  • Targeted gene deletion array: Generate a panel of single and combinatorial knockout mutants for multiple ABC transporter permeases, then comprehensively phenotype them under various growth conditions to identify unique and overlapping functions .

  • Transcriptional response profiling: Perform RNA-seq or microarray analysis comparing wild-type and BRA1188/BS1330_II1179 mutant strains under various environmental conditions to identify genes and pathways specifically affected by this permease .

  • Substrate competition assays: Conduct transport studies with purified reconstituted systems containing different permease proteins and test whether they compete for the same substrates or transport distinct molecules .

  • Chimeric protein analysis: Create chimeric proteins by swapping domains between BRA1188/BS1330_II1179 and other permease proteins to identify regions responsible for specific functional properties or substrate specificities .

  • Protein-protein interaction mapping: Employ techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or cross-linking mass spectrometry to identify unique interaction partners that may provide insights into specific functional pathways .

What is the potential for developing small molecule inhibitors targeting BRA1188/BS1330_II1179 as novel therapeutics against brucellosis?

Developing small molecule inhibitors targeting BRA1188/BS1330_II1179 as novel therapeutics involves a multi-stage drug discovery approach:

  • Target validation: Confirm that inhibition of BRA1188/BS1330_II1179 function significantly impacts bacterial survival or virulence through genetic knockdown studies and functional assays in relevant infection models .

  • High-throughput screening: Establish functional assays suitable for screening compound libraries, such as substrate transport assays in reconstituted systems or whole-cell based reporter systems that indicate transporter inhibition .

  • Structure-based drug design: Utilize structural information (experimental or homology models) to perform virtual screening and rational design of compounds predicted to bind to critical functional sites of the permease protein .

  • Medicinal chemistry optimization: Systematically modify lead compounds to improve potency, selectivity, physicochemical properties, and pharmacokinetic characteristics while maintaining activity against the target .

  • Efficacy and resistance studies: Evaluate promising inhibitors for their ability to clear B. suis infection in cellular and animal models, and assess the potential for resistance development through directed evolution experiments and genetic analysis of spontaneous resistant mutants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.