Recombinant Brucella suis biovar 1 Probable intracellular septation protein A (BR1935, BS1330_I1929)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; BR1935; BS1330_I1929; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
BR1935
Target Protein Sequence
MPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAPIFLATALFMAATVIALAISW SMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIVNTLFGGILLGGLFFGKSLLG YVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFSTDTWVSFKVWGIMPITIVFT LLQMPLIQKHSLTDEENTAS
Uniprot No.

Target Background

Function
Plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links

KEGG: bms:BR1935

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does intracellular septation protein A compare to other Brucella proteins?

Unlike better-characterized Brucella proteins such as the 26 kDa periplasmic immunogenic protein (BP26) or outer membrane proteins (OMPs) that have established roles in bacterial virulence and host immune responses, intracellular septation protein A has been less extensively studied . While proteins like BP26 are primarily involved in immunogenic responses and have been well-characterized for vaccine development, intracellular septation protein A likely plays a more fundamental role in bacterial physiology, specifically in cell division and membrane organization .

Unlike effector proteins such as NyxA and NyxB that directly interfere with host cellular processes (e.g., SENP3 modulation), intracellular septation protein A is primarily involved in bacterial cellular processes . The functional distinction between structural/physiological proteins and virulence factors is important when considering experimental approaches and potential applications.

What expression systems are optimal for recombinant production?

Several expression systems can be used for recombinant production of Brucella suis intracellular septation protein A, each with specific advantages:

Expression SystemAdvantagesDisadvantagesRecommended For
E. coliHigh yield, rapid production, cost-effectiveLimited post-translational modificationsBasic structural studies, antibody production
YeastGood yield, some post-translational modificationsMore complex than E. coliFunctional studies requiring some modifications
Insect cellsBetter post-translational modificationsLower yield, longer production timeStudies requiring authentic protein folding
Mammalian cellsMost authentic post-translational modificationsLowest yield, most expensive, longest production timeStudies requiring full activity and native conformation

E. coli and yeast systems typically offer the best combination of yield and production time for this protein . For example, the recombinant form available commercially is expressed in E. coli with an N-terminal His tag, which facilitates purification while maintaining the protein's basic structural properties .

What purification strategies yield the highest purity?

For His-tagged recombinant intracellular septation protein A, a multi-step purification process is recommended:

  • Initial capture using Immobilized Metal Affinity Chromatography (IMAC) with Ni-NTA or Co-NTA resins

  • Intermediate purification with ion exchange chromatography (typically anion exchange)

  • Polishing step using size exclusion chromatography to remove aggregates

This approach typically yields >90% purity as determined by SDS-PAGE . For membrane proteins like intracellular septation protein A, inclusion of appropriate detergents throughout the purification process is critical to maintain solubility. Common detergents include n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations above their critical micelle concentration.

How should the purified protein be stored to maintain activity?

Optimal storage conditions for recombinant intracellular septation protein A include:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Long-term storage: -20°C or -80°C in aliquots to avoid freeze-thaw cycles

  • Addition of 5-50% glycerol as a cryoprotectant (with 50% being commonly used)

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0

For reconstitution of lyophilized protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. It's crucial to avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and promote aggregation .

How can intracellular septation protein A be used in Brucella pathogenesis studies?

Recombinant intracellular septation protein A can be utilized in several experimental approaches to understand Brucella pathogenesis:

  • Knockout/knockdown studies: Creating BR1935/BS1330_I1929-deficient Brucella strains to assess the impact on bacterial division, membrane integrity, and virulence, similar to studies with MapB-deficient strains .

  • Protein-protein interaction studies: Identifying bacterial or host proteins that interact with intracellular septation protein A using pull-down assays with the His-tagged recombinant protein.

  • Localization studies: Using fluorescently labeled antibodies against the recombinant protein to track its location during different stages of bacterial infection and cell division.

  • Structure-function analyses: Creating targeted mutations in the protein to identify domains essential for septation function and assessing their impact on bacterial fitness during infection.

These approaches can reveal whether intracellular septation protein A contributes to Brucella's ability to survive intracellularly, similar to how other membrane proteins have been found to contribute to virulence .

What cell models are appropriate for studying this protein's function?

Several cell models can be used to study intracellular septation protein A function in the context of Brucella pathogenesis:

Cell ModelApplicationsKey Considerations
Macrophage cell lines (RAW264.7, J774)Intracellular survival, trafficking studiesStandard models for Brucella infection studies
Primary macrophagesPhysiologically relevant immune responsesMore variable than cell lines but more authentic
Epithelial cells (HeLa)Alternative infection modelUseful for comparing different host cell environments
Trophoblast cell linesReproductive tract tropism studiesRelevant for understanding abortion mechanisms in animals

When designing experiments with these cell models, it's important to include appropriate controls such as heat-killed bacteria (HKB) for comparison and to standardize infection protocols including multiplicity of infection (MOI) and timepoints .

What is known about post-translational modifications of intracellular septation protein A?

While specific post-translational modifications of Brucella suis intracellular septation protein A have not been extensively characterized in the literature, membrane proteins in bacteria commonly undergo modifications that affect their localization, stability, and function. Potential modifications may include:

  • Lipidation: Addition of lipid moieties to anchor the protein in the membrane

  • Phosphorylation: Regulation of protein activity in response to environmental signals

  • Proteolytic processing: Maturation of the protein to its active form

The choice of expression system significantly impacts these modifications. While E. coli expression is efficient, it may not reproduce all native modifications . For studies focused on protein function that may depend on specific modifications, mammalian or insect cell expression systems would be more appropriate despite their lower yields .

How might intracellular septation protein A contribute to Brucella virulence?

While direct evidence linking intracellular septation protein A to Brucella virulence is limited, its role in septation suggests several potential mechanisms of contribution:

  • Intracellular adaptation: Proper bacterial cell division is crucial for adaptation to the intracellular environment and establishment of the replicative niche.

  • Membrane integrity: As a membrane protein, it may contribute to membrane homeostasis, similar to how MapB affects cell envelope properties and influences the composition of outer membrane vesicles (OMVs), which are important for Brucella virulence and immune evasion .

  • Stress response: Septation proteins may be involved in bacterial responses to stressors encountered within host cells.

Comparative studies with other Brucella membrane proteins have shown that alterations in membrane composition can significantly affect bacterial survival and immunogenic properties. For example, mutation of the mapB gene results in changes to OMV composition that influence immune responses to Brucella .

How can researchers overcome challenges in membrane protein expression?

Expression of membrane proteins like intracellular septation protein A presents several challenges. Researchers can implement these strategies to improve results:

  • Optimization of expression conditions:

    • Reduce expression temperature (16-25°C)

    • Use weaker promoters to slow protein production

    • Test different E. coli strains (C41, C43, Lemo21) specifically engineered for membrane protein expression

  • Fusion partners and solubility tags:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

  • Detergent screening:

    • Systematic testing of different detergents for extraction

    • Detergent mixtures often perform better than single detergents

    • Consider using amphipols or nanodiscs for downstream applications

  • Cell-free expression systems:

    • Allows direct incorporation into liposomes or nanodiscs

    • Avoids toxicity issues associated with overexpression in living cells

A systematic approach testing multiple conditions simultaneously will typically yield the most efficient path to successful expression.

What controls should be included in functional studies?

When conducting functional studies with recombinant intracellular septation protein A, include these essential controls:

  • Negative controls:

    • Heat-inactivated protein to confirm activity-dependent effects

    • Irrelevant protein of similar size and preparation method

    • Buffer-only controls to detect buffer component effects

  • Positive controls:

    • Known functional membrane protein from Brucella

    • Commercial protein standards where applicable

  • Validation controls:

    • Multiple batches of protein to ensure reproducibility

    • Endotoxin testing to ensure observed effects aren't due to contamination

    • Activity assays to confirm protein functionality

  • Genetic controls:

    • Complementation studies in knockout strains

    • Dose-response relationships to establish specificity

These controls help distinguish specific effects of the protein from non-specific or contaminant-related observations, particularly important when working with proteins expressed in bacterial systems that may contain endotoxins or other immunostimulatory components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.