Recombinant Brucella suis biovar 1 Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella suis biovar 1 Protease HtpX Homolog (HtpX)

Recombinant Brucella suis biovar 1 Protease HtpX homolog (HtpX) is a protein expressed by the bacterium Brucella suis biovar 1 . Brucella suis is a pathogenic bacterium known to cause brucellosis, an infectious disease that affects both animals and humans . Specifically, HtpX is a protease homolog, indicating its similarity to other HtpX proteases found in various organisms . Proteases are enzymes that catalyze the breakdown of proteins, playing critical roles in numerous cellular processes.

Characteristics of HtpX

CharacteristicDescription
SpeciesBrucella suis biovar 1 (strain 1330)
Uniprot NO.Q8FYQ1
EC Number3.4.24.-
Gene NamehtpX
Ordered Locus NamesBR1813, BS1330_I1807
Expression Region1-325
AA SequenceMNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQEVDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNR LSPEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVG TLLAMIVAPFAAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEHNPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNSGPWGQRSDNAGGNSNGGSRYRGPWS
Molecular Weightapproximately 36 kDa

Recombinant Production and Applications

Recombinant HtpX is produced using genetic engineering techniques, where the gene encoding HtpX is inserted into a host organism (e.g., E. coli) to produce large quantities of the protein . This recombinant form of HtpX is valuable for research purposes, including:

  • ELISA assays: Recombinant HtpX can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect antibodies against Brucella suis in serum samples . This can aid in the diagnosis of brucellosis.

  • Structural and functional studies: Recombinant HtpX allows researchers to study the protein's structure, enzymatic activity, and interactions with other molecules.

  • Vaccine development: HtpX may be explored as a potential vaccine candidate or target for developing new therapies against Brucella infections.

Relevance to Brucellosis Research

Brucella suis can replicate inside mammalian cells, and their type IV secretion system is needed for survival inside cells and replication . Studying proteins like HtpX can reveal important details about the mechanisms that contribute to the bacterium's ability to cause disease. Further research on HtpX and other Brucella suis proteins may lead to the development of more effective diagnostic tools, treatments, and preventive measures against brucellosis.

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. Dry ice shipping is available upon request but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
htpX; BR1813; BS1330_I1807; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFAAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links

KEGG: bms:BR1813

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Brucella suis biovar 1 Protease HtpX homolog and what is its significance in bacterial physiology?

    Protease HtpX homolog (htpX) is a membrane-bound zinc metalloprotease found in Brucella suis biovar 1 and other Brucella species. The protein consists of 325 amino acids and functions primarily in protein quality control and stress response mechanisms.

    The protein belongs to the M48 peptidase family and is characterized by the presence of a HEXXH zinc-binding motif. In Brucella suis biovar 1 (strain 1330), HtpX is encoded by gene BS1330_I1807 (also designated as BR1813) . The protein functions as a membrane protease involved in degrading misfolded membrane proteins, particularly under stress conditions, which may contribute to bacterial survival during infection.

    The amino acid sequence of Brucella suis HtpX shows significant homology to HtpX proteins in other Brucella species, with nearly identical sequences observed in B. abortus . This high conservation suggests an essential role in Brucella physiology.

  • What are the optimal expression systems for recombinant Brucella suis HtpX production?

    For successful production of recombinant Brucella suis HtpX, E. coli-based expression systems have been most commonly employed. Based on available research protocols:

    • Expression vector: pET vectors (particularly pET-DEST42) have been used successfully for Brucella outer membrane proteins

    • Host strain: E. coli BL21 cells are preferred for IPTG-induced protein expression

    • Induction conditions: IPTG induction following transformation into expression hosts

    • Tags: N-terminal or C-terminal His-tags facilitate purification and detection

    Methodology:

    1. PCR amplification of the htpX gene from Brucella suis genomic DNA

    2. Cloning into an entry vector and verification

    3. Recombination into destination expression vector (pET-DEST42)

    4. Transformation into E. coli BL21 cells

    5. IPTG-induced expression

    6. Verification by Western blot using anti-His antibodies

    This approach has yielded recombinant proteins with >90% purity as determined by SDS-PAGE analysis .

  • What are the recommended storage and handling conditions for recombinant Brucella HtpX?

    Optimal storage and handling conditions for recombinant Brucella HtpX protein:

    ParameterRecommendation
    Storage temperature-20°C/-80°C for extended storage
    Working aliquotsStore at 4°C for up to one week
    Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer with 50% glycerol
    Recommended formLyophilized powder for long-term storage
    ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
    For long-term storageAdd 5-50% glycerol (final concentration) and aliquot
    Important noteAvoid repeated freeze-thaw cycles

    Prior to opening, briefly centrifuge vials to bring contents to the bottom. After reconstitution, the addition of glycerol (typically to 50% final concentration) helps maintain protein stability during freeze-thaw cycles if necessary .

Advanced Research Applications

Immunological and Diagnostic Applications

  • Has HtpX been evaluated as a component in subunit vaccine development against Brucellosis?

    While HtpX specifically has not been extensively studied as a vaccine candidate, research on similar Brucella proteins provides a methodological framework:

    Potential as a vaccine component:

    • As a conserved membrane protein, HtpX could represent a target for protective immunity

    • Recombinant HtpX could be included in multi-epitope vaccines

    Methodological approach based on similar studies:

    1. Epitope mapping to identify immunogenic regions

    2. Design of multi-epitope constructs incorporating HtpX epitopes

    3. Expression and purification of recombinant proteins

    4. Immunization studies with appropriate adjuvants

    5. Challenge studies to assess protection

    A study on multi-epitope protein vaccines for Brucellosis demonstrated that "recombinant protein could be a subunit protein with sufficient efficiency in stimulating the humoral and cellular-mediated immune system against B. melitensis compared with common live attenuated B. melitensis Rev.1 vaccines." Similar approaches could be applied to assess HtpX as a vaccine component.

    Experimental design would include:

    • T and B cell epitope prediction from HtpX sequence

    • Evaluation of immune responses (IFN-γ, IL-2, specific IgG)

    • Lymphocyte proliferation assays

    • Protection studies in animal models

  • How can recombinant HtpX be used in diagnostic applications for Brucellosis?

    Recombinant Brucella proteins have significant potential for improving diagnostic tests. For HtpX:

    Serological diagnostics:

    • ELISA development using purified recombinant HtpX

    • Western blot confirmation tests

    • Lateral flow assays for point-of-care testing

    Methodological considerations:

    1. Optimization of antigen coating concentration

    2. Determination of serum dilution parameters

    3. Establishment of cutoff values using known positive and negative samples

    4. Evaluation of sensitivity and specificity

    5. Cross-reactivity assessment with other bacterial infections

    Validation approach:

    • Testing against serum panels from confirmed Brucella infections

    • Comparison with existing diagnostic methods

    • Field testing in endemic regions

    Research has shown that some Brucella outer membrane proteins demonstrate "high binding activity with immunized rabbit antiserum" , suggesting potential diagnostic utility. For HtpX specifically, evaluation is needed to determine if it elicits a consistent and detectable antibody response during natural infection that could be leveraged for diagnostic purposes.

  • What is the relationship between HtpX and the BvrR/BvrS regulatory system in Brucella?

    The BvrR/BvrS two-component system is essential for Brucella virulence, and its relationship with membrane proteins like HtpX is of research interest:

    The BvrR/BvrS system:

    • Controls polycation peptide resistance, invasion, and intracellular survival

    • Regulates outer membrane structure and components

    • Controls expression of outer membrane proteins like Omp3a and Omp3b

    Potential relationship with HtpX:

    • BvrR/BvrS may regulate htpX expression directly or indirectly

    • HtpX could process membrane proteins that are under BvrR/BvrS control

    • Both systems may function in coordinated response to environmental stresses

    Research has shown that "BvrR/BvrS regulates the structure of outer membrane components important for homeostasis and virulence" . As a membrane protease involved in protein quality control, HtpX might play a role in maintaining membrane integrity under BvrR/BvrS regulation.

    Experimental approaches to investigate this relationship could include:

    • Transcriptome analysis of bvrR/bvrS mutants to assess htpX expression

    • ChIP-seq to determine if BvrR directly binds the htpX promoter

    • Phenotypic analysis of double mutants (htpX and bvrR/bvrS components)

Structural and Functional Characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.