Recombinant Brucella suis biovar 1 Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
crcB1; BR1369; BS1330_I1364; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
crcB1
Target Protein Sequence
MTREFIMLMMPPLTDGFPLDILVANVVACFLLGTVTALYARKIHSRDVHTIIGMGMMGGV STFSSFAYGSVVLASASMSAFLIAAAYVTVSVVAGYVAVLAGMKFGEKSADILHRYPPMA SIIDSGLVTVESRHSVAETIERVAAKAKSMGMNVFTRVDHGAGAKEAGLGLPPTELIIFG NPQNGTVLMQDKRTIGLDLPIRALAWEDGSGKVWLTVNDPAWLAQRHSLGLSSDVAIKAM VTGTGTVTKYAAGD
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: bms:BR1369

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Brucella suis biovar 1 Protein CrcB homolog 1 (crcB1)?

Recombinant Brucella suis biovar 1 Protein CrcB homolog 1 (crcB1) is a bacterial membrane protein that functions as a putative fluoride ion transporter. Similar to its paralog crcB2, it belongs to the CrcB protein family which plays a crucial role in fluoride resistance mechanisms in bacteria . The protein is characterized by its transmembrane domains that form channels allowing for the selective transport of fluoride ions across the bacterial cell membrane. While specific data on crcB1 is limited, structural analysis suggests it forms protein channels that facilitate the export of toxic fluoride ions from bacterial cells, serving as a protective mechanism against fluoride toxicity .

How does crcB1 differ from crcB2 in Brucella suis biovar 1?

While both crcB1 and crcB2 function as putative fluoride ion transporters in Brucella suis biovar 1, they exhibit distinct structural and functional characteristics. The crcB2 protein has been characterized as having specific domains involved in fluoride recognition and transport . Though they share sequence homology, they likely have differential expression patterns or respond to different environmental stimuli. Research indicates that these paralogs may provide redundancy in fluoride ion transport capabilities, ensuring bacterial survival under varying environmental conditions. The specific differences in binding affinity, transport kinetics, and regulation mechanisms between crcB1 and crcB2 remain areas of active investigation in the field.

What expression systems are suitable for producing recombinant crcB1 protein?

Multiple expression systems have proven effective for the production of recombinant CrcB proteins, which can be extrapolated to crcB1 production. Based on available data for similar proteins, several expression systems can be considered:

Expression SystemAdvantagesChallengesTypical Yield
E. coliHigh yield, cost-effective, rapid growthPotential improper folding of membrane proteins3-5 mg/L culture
YeastBetter for eukaryotic post-translational modificationsLonger production time1-3 mg/L culture
BaculovirusExcellent for complex membrane proteinsMore expensive, technically demanding2-4 mg/L culture
Mammalian cellBest for maintaining native structureHighest cost, lowest yield0.5-1 mg/L culture

For research applications requiring highly purified protein, E. coli systems with specialized tags (such as Avi-tag Biotinylated variants) provide good yields while maintaining functionality . For structural studies or binding assays, baculovirus or mammalian expression systems may provide protein with more native-like properties despite lower yields.

What is the functional relationship between crcB1 and fluoride ion homeostasis in Brucella suis?

The crcB1 protein, like other CrcB family members, plays a critical role in fluoride ion homeostasis in Brucella suis. Research on fluoride-specific ion channels indicates that these specialized protein structures create pathways for fluoride ions to be exported from bacterial cells . In bacteria, fluoride ions at sufficient concentrations can be highly toxic, interfering with essential enzymes, disrupting protein function, and compromising cellular metabolism. The crcB1 protein likely forms part of a defense mechanism that helps maintain internal fluoride concentrations below toxic thresholds.

Molecular studies of similar fluoride channels reveal that they function through specific binding interactions with fluoride ions, creating selective pores that preferentially transport fluoride across the membrane barrier. The structure of these channels provides an "atomic blueprint" that enables the recognition and transport of fluoride ions while excluding other similarly sized anions . In Brucella suis, this mechanism would be particularly important for survival in fluoride-rich environments or during host immune responses that might leverage fluoride as an antimicrobial strategy.

How do post-translational modifications affect crcB1 function and interaction capabilities?

Post-translational modifications (PTMs) significantly impact the function and interaction capabilities of membrane proteins like crcB1. For recombinant crcB proteins, the addition of specific tags can alter binding properties and detection capabilities. For instance, the Avi-tag Biotinylated modification, which involves the covalent attachment of biotin to a specific lysine residue in the AviTag peptide by E. coli biotin ligase (BirA), enables highly specific protein detection and purification .

These modifications can affect:

  • Protein stability and half-life in experimental conditions

  • Binding affinity for fluoride ions and transport kinetics

  • Interaction with other bacterial or host proteins

  • Immune recognition and antigenicity in host systems

Research approaches utilizing differential tagging strategies (N-terminal versus C-terminal) have revealed that the carboxy-terminal domain of similar channels plays a crucial role in protein-protein interactions . Therefore, careful consideration should be given to tag placement when designing experiments to study crcB1 function, as improper tag positioning could disrupt critical functional domains.

What role might crcB1 play in Brucella suis virulence and host-pathogen interactions?

The potential role of crcB1 in Brucella suis virulence relates to its function in bacterial survival under stress conditions. Experimental studies on Brucella suis have demonstrated that bacterial antigens can induce specific immune responses in infected hosts . The ability of bacteria to maintain homeostasis against host defense mechanisms, including potential fluoride-based antimicrobial strategies, directly impacts their virulence.

Tissue culture studies have shown that heat-killed Brucella suis preparations exhibit differential toxicity to splenic cells from infected versus non-infected guinea pigs, suggesting specific immune recognition of Brucella components . Macrophages showed particular sensitivity to Brucella antigens, which is significant given that macrophages are primary target cells for Brucella infection. While these studies did not specifically examine crcB1, they establish a framework for understanding how bacterial components, potentially including crcB1, interact with host immune cells.

The crcB1 protein, as a membrane-associated component, may be recognized by the host immune system. Additionally, its function in maintaining bacterial homeostasis under stress could contribute to bacterial persistence within host cells, particularly within the challenging environment of macrophages.

What are the optimal conditions for expressing and purifying functional crcB1 protein?

Optimal expression and purification of functional crcB1 protein requires careful consideration of several critical factors:

ParameterRecommended ConditionsRationale
Expression systemE. coli BL21(DE3)Balance of yield and proper folding
Induction0.5 mM IPTG, 18°C, 16-20 hoursSlower expression improves folding
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsStabilizes membrane proteins
Detergent1% DDM or LMNGEffective for membrane protein extraction
PurificationIMAC followed by size exclusion chromatographyTwo-step purification for >85% purity
StorageLyophilized powder or with 5-50% glycerol at -80°CPreserves activity during storage

The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and for long-term storage, the addition of 5-50% glycerol is recommended . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. For membrane proteins like crcB1, maintaining the correct folding and structural integrity is particularly challenging but essential for functional studies.

How can researchers effectively design binding assays to study crcB1 interactions with fluoride ions?

Designing effective binding assays for studying crcB1 interactions with fluoride ions requires specialized approaches for membrane proteins:

  • Fluorescence-based assays: Using fluoride-sensitive probes or fluorescently labeled proteins can enable real-time monitoring of binding kinetics. Fluorescence polarization techniques have proven effective for studying protein-protein interactions and could be adapted for fluoride binding studies .

  • Isothermal Titration Calorimetry (ITC): This technique measures heat changes during binding events and can provide detailed thermodynamic parameters of crcB1-fluoride interactions.

  • Surface Plasmon Resonance (SPR): For immobilized crcB1 protein, SPR can detect binding events in real-time without requiring fluorescent labels.

  • Electrophysiology approaches: For functional characterization, reconstituting crcB1 in liposomes or planar lipid bilayers allows direct measurement of ion transport using patch-clamp techniques.

When designing these assays, researchers should consider the physiological concentration range of fluoride (typically micromolar to millimolar) and maintain appropriate pH, as the protonation state of fluoride can affect binding. Control experiments using other halide ions can help establish specificity, while mutagenesis studies targeting predicted binding site residues can confirm critical interaction points.

How should researchers interpret contradictory findings in crcB protein family studies?

When faced with contradictory findings in studies of the crcB protein family, researchers should implement a systematic approach to data analysis and interpretation:

  • Evaluate experimental conditions: Different expression systems, purification methods, and assay conditions can significantly impact protein behavior and experimental outcomes . Compare methodological details across studies to identify variables that might explain discrepancies.

  • Consider protein homology versus function: While crcB1 and crcB2 share sequence similarity, they may have distinct functional roles or regulatory mechanisms. Not all homologous proteins exhibit identical characteristics despite structural similarities .

  • Assess cross-species variations: CrcB proteins from different bacterial species or strains may have evolved different properties to adapt to their specific environmental niches. Direct comparisons should account for phylogenetic relationships.

  • Examine protein-protein interactions: Interaction partners can modulate protein function, and discrepancies may arise from studying the protein in isolation versus in its native context with binding partners .

  • Apply multiple complementary techniques: Triangulating findings using different experimental approaches provides stronger evidence and can help resolve contradictions. For example, combining structural studies with functional assays and computational modeling.

  • Consider post-translational modifications: The presence or absence of specific modifications can significantly alter protein behavior .

What statistical approaches are most appropriate for analyzing crcB1 structure-function relationships?

For analyzing structure-function relationships of crcB1, several statistical approaches are particularly valuable:

  • Multiple sequence alignment analysis: Using statistical measures of conservation to identify functionally important residues across the CrcB family. Conservation scores can highlight residues under evolutionary pressure, suggesting functional importance.

  • Principal Component Analysis (PCA): For analyzing structural dynamics data from molecular dynamics simulations, PCA can identify the most significant collective motions that might relate to function.

  • Hierarchical clustering: For grouping similar conformational states or binding modes observed in simulations or experimental studies.

  • Bayesian network analysis: For inferring causal relationships between structural features and functional outcomes.

  • Molecular dynamics simulation analysis: Statistical analysis of trajectories can reveal conformational ensembles and energetics of fluoride binding and transport.

What emerging technologies could advance our understanding of crcB1 function in Brucella suis?

Several cutting-edge technologies hold promise for deepening our understanding of crcB1 function:

  • Cryo-electron microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology, enabling visualization of proteins in near-native states without crystallization. Applying cryo-EM to crcB1 could reveal its complete structure, including conformational changes during fluoride transport .

  • Single-molecule fluorescence resonance energy transfer (smFRET): This approach can track real-time conformational changes in individual protein molecules, potentially revealing the dynamic mechanism of fluoride transport through crcB1 channels.

  • CRISPR-Cas9 gene editing in Brucella: Precise genomic modifications can create crcB1 variants to test structure-function hypotheses directly in the native organism, revealing physiological roles not apparent in recombinant systems.

  • Advanced computational approaches: Molecular dynamics simulations using specialized force fields for membrane environments, combined with machine learning approaches, can predict ion transport mechanisms and guide experimental design.

  • Microfluidic devices: These platforms can precisely control the microenvironment around bacteria, allowing real-time monitoring of fluoride transport under controlled conditions that mimic host environments.

  • In situ structural biology approaches: Techniques like electron tomography could eventually visualize crcB1 distribution and organization within intact bacterial cells.

How might understanding crcB1 contribute to novel therapeutic strategies against brucellosis?

Understanding crcB1 structure and function could lead to innovative therapeutic strategies against brucellosis:

  • Target-based drug design: With detailed structural information about crcB1, researchers could design small molecule inhibitors that specifically block fluoride export, potentially increasing fluoride toxicity selectively in Brucella . This approach could leverage the natural antibacterial properties of fluoride while minimizing host toxicity.

  • Vaccine development: Recombinant crcB1 protein or attenuated Brucella strains with modified crcB1 could serve as vaccine candidates. Experimental brucellosis studies have shown that specific immune responses can be generated against Brucella components . A deeper understanding of how crcB1 interacts with the host immune system could inform vaccine design strategies.

  • Combination therapies: Identifying interactions between crcB1 and host factors could reveal opportunities for combination therapies that simultaneously target bacterial survival mechanisms and enhance host immune responses.

  • Diagnostic applications: Knowledge of crcB1 structure and epitopes could enable the development of more specific diagnostic tests for brucellosis, potentially allowing strain-specific identification.

  • Engineered probiotics: Creating non-pathogenic bacteria that express crcB1-targeting molecules could provide a novel delivery system for anti-Brucella therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.