The Recombinant Brucella suis biovar 1 Putative peptide transport system permease protein BRA1093/BS1330_II1085 (UniProt ID: Q8FUW9) is a full-length bacterial protein expressed in E. coli with an N-terminal His-tag. It belongs to the ABC transporter family and is annotated as a permease component of a peptide transport system. Key attributes include:
| Parameter | Value |
|---|---|
| Gene Name | BRA1093 (BS1330_II1085) |
| Protein Length | 1–296 amino acids (full-length) |
| Molecular Weight | ~33.5 kDa (estimated from sequence) |
| Tag | N-terminal His-tag |
| Expression System | E. coli |
| Purity | >90% (SDS-PAGE) |
| Storage | Lyophilized powder; store at -20°C/-80°C |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL); glycerol recommended for stability |
BRA1093 functions as a permease subunit in an oligopeptide transport system (OPP), part of the ABC transporter family (TC 3.A.1.5.2) . This system facilitates the uptake of short peptides, which are critical for bacterial nutrient acquisition, stress response, and pathogenesis.
While direct evidence for BRA1093’s role in virulence is limited, ABC transporters in Brucella are essential for survival within host cells. For example:
Outer membrane stability: ABC transporters contribute to membrane integrity, enabling resistance to host antimicrobial peptides .
Nutrient scavenging: Peptide transport supports growth in nutrient-limited environments, such as host macrophages .
The BRA1093 sequence (MTELASPTSFSMPDIGKSPVVLTARRLMRRRSFRIGLVLLLIVVLAAVLAPWITNGKPNA...) contains conserved motifs typical of ABC permeases, including transmembrane domains and regions for substrate binding .
Storage: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .
Buffer: Tris/PBS-based with 6% trehalose (pH 8.0) for stabilization .
While BRA1093 has not been directly tested in serological assays, peptide ABC transporters in Brucella show promise as genus-specific antigens:
BRA1093 is located on chromosome II of Brucella suis 1330 (NC_004311.2), within a genomic region encoding ABC transporters .
Homology: High similarity across Brucella species (e.g., B. abortus, B. melitensis) .
Annotations: Classified as a putative dipeptide transport permease in some databases .
Purity: Requires optimization for large-scale production.
Stability: Susceptible to aggregation; glycerol addition improves long-term storage .
KEGG: bms:BRA1093
The BRA1093/BS1330_II1085 protein functions as a permease component of a peptide transport system in Brucella suis biovar 1. Based on structural and functional homology with other characterized Brucella permeases, this protein likely forms part of an ATP-binding cassette (ABC) transporter system specialized for peptide uptake. Genomic analysis of Brucella species reveals that similar permease proteins, such as BR0952 and BR0953, are involved in amino acid transport across the bacterial membrane . Transcription studies confirm the expression of these transporter genes in B. suis under standard laboratory growth conditions, suggesting their important role in nutrient acquisition .
The substrate specificity of this permease likely contributes to the organism's ability to survive in nutrient-limited environments, particularly within host cells. Similar to other peptide transporters like Ptr2p in Saccharomyces cerevisiae, BRA1093/BS1330_II1085 may exhibit substrate multispecificity, potentially recognizing a range of di/tripeptides with varying affinities . This multispecificity would provide a selective advantage for bacterial survival in diverse environments.
While the specific structure of BRA1093/BS1330_II1085 has not been fully characterized, insights can be gained through comparative analysis with related bacterial permeases. The protein belongs to the family of ABC transporter permeases, which typically contain multiple transmembrane domains that form a channel for substrate passage across the membrane.
Recent structural studies of bacterial peptide transporters provide valuable reference points. For example, the structures of PepTso from Shewanella oneidensis and PepTst15 from Streptococcus thermophilus have been determined, offering important structural models for understanding peptide transport mechanisms . These structures reveal common architectural features that may be shared with BRA1093/BS1330_II1085, including transmembrane helices arranged to form a substrate-binding cavity.
Sequence alignments with other characterized Brucella permeases such as BR0952 and BR0953 would provide additional insights into conserved structural elements. These Brucella-specific permeases have been experimentally confirmed as amino acid ABC transporter permease proteins .
The genomic context of BRA1093/BS1330_II1085 provides insights into its functional associations. Similar to other ABC transporter systems in Brucella, this gene likely resides in an operon containing additional components of the transport machinery, including an ATP-binding protein and possibly a substrate-binding protein.
Comprehensive genomic comparisons between B. abortus, B. melitensis, and B. suis have revealed significant differences in their transporter gene complement . The BRA1093/BS1330_II1085 gene may be part of the species-specific genetic features that contribute to the distinct ecological adaptations of B. suis. Notably, B. suis contains unique transport-related genes not found in other Brucella species, suggesting specialized metabolic capabilities .
RT-PCR analysis of transporter genes in Brucella species has demonstrated variable expression patterns, reflecting differential regulation across species. For example, B. suis-specific transporters like BR0952 and BR0953 show detectable transcription when grown in standard laboratory conditions .
Characterizing the substrate specificity of BRA1093/BS1330_II1085 requires a multi-faceted approach combining biochemical, genetic, and computational methods. One effective strategy involves adapting the F-CUp assay used to characterize the yeast peptide transporter Ptr2p . This assay allows for high-throughput screening of substrate preferences using peptide libraries.
For comprehensive analysis, researchers should:
Generate a recombinant expression system for BRA1093/BS1330_II1085, ensuring proper membrane integration and function
Develop a standardized transport assay using either radiolabeled or fluorescently labeled peptide substrates
Screen a diverse library of di/tripeptides to establish affinity profiles (Kᵢ values)
Analyze the structural features of high-affinity versus low-affinity substrates
Based on studies of related peptide transporters, substrate affinities may vary widely, from micromolar to millimolar ranges . For example, the yeast Ptr2p exhibits Kᵢ values ranging from 0.020 mM to 48 mM for different dipeptides . A similar comprehensive analysis of BRA1093/BS1330_II1085 would reveal its substrate preference patterns and potential role in nutrient acquisition during infection.
Computational modeling using established prediction algorithms can augment experimental data. Studies with the yeast Ptr2p transporter achieved 97% accuracy in ligand affinity prediction using comprehensive screening data combined with simple property indices for describing ligand molecules .
The role of BRA1093/BS1330_II1085 in virulence likely relates to its function in nutrient acquisition during infection. Peptide transporters are crucial for bacterial survival in nutrient-limited host environments, potentially contributing to pathogenesis through several mechanisms:
Facilitating acquisition of essential amino acids from host-derived peptides
Contributing to stress response during intracellular survival
Potentially modulating host immune responses through peptide uptake or export
To investigate these potential roles, researchers should:
Generate knockout mutants lacking functional BRA1093/BS1330_II1085
Assess growth and survival in peptide-defined minimal media
Evaluate intracellular replication in macrophage infection models
Conduct in vivo virulence studies in appropriate animal models
Comparative genomic analyses between Brucella species have identified transport-related genes as potential virulence factors. For example, a 25 kb region present in B. suis and B. melitensis but absent in B. abortus contains several transporters and glycosyl transferases potentially involved in virulence . While BRA1093/BS1330_II1085 is not specifically mentioned in this region, similar species-specific transporters may contribute to the distinct host preferences and virulence characteristics of B. suis.
Successful expression and purification of membrane proteins like BRA1093/BS1330_II1085 requires careful optimization of multiple parameters. Based on protocols for similar bacterial membrane proteins, the following approach is recommended:
Expression System Selection:
E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression
Expression vectors with tunable promoters (e.g., T7lac) allow controlled expression rates
Optimized Expression Conditions:
Induce at mid-log phase (OD₆₀₀ = 0.6-0.8) with reduced IPTG concentration (0.1-0.5 mM)
Lower post-induction temperature (16-20°C) for 16-20 hours
Supplement media with specific membrane protein expression enhancers
Membrane Protein Extraction:
Gentle cell lysis using specialized buffers containing appropriate detergents
Optimize detergent selection (DDM, LDAO, or C₁₂E₈) for stability and activity
Purification Strategy:
Initial purification via affinity chromatography (His-tag recommended)
Secondary purification by size exclusion chromatography
Maintain protein stability with appropriate detergent throughout purification
Protocols for recombinant membrane proteins from Brucella species suggest that E. coli expression systems can yield functional proteins with proper optimization . For example, recombinant Brucella membrane proteins like the putative membrane protein insertion efficiency factor (BR1073, BS1330_I1069) have been successfully expressed in E. coli with >85% purity as assessed by SDS-PAGE .
A critical consideration is maintaining protein stability during purification. The shelf life of purified membrane proteins is typically 6 months at -20°C/-80°C in liquid form or 12 months in lyophilized form, with proper storage conditions .
Quantitative measurement of transport activity requires both in vitro and in vivo assay systems that accurately reflect the physiological function of BRA1093/BS1330_II1085. Several complementary approaches are recommended:
Proteoliposome-Based Transport Assays:
Reconstitute purified BRA1093/BS1330_II1085 into liposomes with associated ATP-binding protein
Measure uptake of radiolabeled or fluorescently labeled peptide substrates
Determine transport kinetics (Kₘ, Vₘₐₓ) for various substrates
Whole-Cell Transport Assays:
Express BRA1093/BS1330_II1085 in a heterologous system lacking endogenous peptide transporters
Measure cellular accumulation of labeled peptides
Compare uptake in cells expressing BRA1093/BS1330_II1085 versus control cells
Competition Assays:
Use a fixed concentration of reporter substrate with varying concentrations of unlabeled competitor substrates
Calculate IC₅₀ values to determine relative affinity for different peptides
The F-CUp assay used to characterize the yeast peptide transporter Ptr2p represents a particularly valuable approach . This assay has successfully characterized the substrate multispecificity of transporters, revealing affinities (Kᵢ values) ranging from 0.020 mM to 48 mM for different dipeptides .
For meaningful interpretation, transport data should be normalized to protein expression levels, confirmed by Western blotting or other quantitative protein assays. Additionally, proper controls should include ATPase inhibitors to confirm ATP-dependent transport for ABC transporters.
Comprehensive analysis of BRA1093/BS1330_II1085 expression and regulation requires integrated genomic and transcriptomic approaches:
Promoter Analysis and Transcriptional Start Site Mapping:
Rapid Amplification of cDNA Ends (RACE) to identify transcriptional start sites
Reporter gene fusions to map promoter elements and regulatory regions
DNA-binding assays to identify regulatory proteins interacting with the promoter
Transcriptomic Profiling:
RNA-Seq analysis under various growth conditions and stress exposures
Comparison of transcription in wild-type versus regulatory mutants
Co-expression network analysis to identify genes with correlated expression patterns
Targeted Expression Analysis:
RT-PCR and qRT-PCR for specific measurement of BRA1093/BS1330_II1085 transcript levels
Northern blotting to assess transcript size and stability
In situ hybridization for spatial localization in infected tissues
RT-PCR has been successfully applied to detect transcription of transporter genes in Brucella species, as demonstrated for B. suis-specific transporters BR0952 and BR0953 . This approach confirmed the transcriptional activity of these genes under standard laboratory growth conditions .
The table below presents a comparative analysis of different transcriptomic methods:
| Method | Resolution | Throughput | Advantages | Limitations |
|---|---|---|---|---|
| RT-PCR | Single gene | Low | Simple, specific | Limited to targeted genes |
| qRT-PCR | Single gene | Medium | Quantitative, sensitive | Limited to targeted genes |
| RNA-Seq | Genome-wide | High | Comprehensive, unbiased | Complex analysis, cost |
| Northern blot | Single gene | Low | Transcript size information | Labor-intensive, low sensitivity |
Developing structural models of BRA1093/BS1330_II1085 requires an integrated approach combining computational prediction with experimental validation:
Computational Modeling Approach:
Homology modeling based on crystal structures of related bacterial peptide transporters
Template selection from structurally characterized transporters such as PepTso from Shewanella oneidensis and PepTst15 from Streptococcus thermophilus
Refinement of models through molecular dynamics simulations in a membrane environment
Identification of potential substrate binding pockets and critical residues
Experimental Validation of Structural Predictions:
Site-directed mutagenesis of predicted functional residues
Cross-linking studies to validate predicted domain interactions
Limited proteolysis to identify domain boundaries and flexible regions
Spectroscopic techniques (CD, FTIR) to analyze secondary structure content
Advanced Structural Analysis (longer-term goals):
X-ray crystallography of purified protein (challenging for membrane proteins)
Cryo-electron microscopy for structure determination without crystallization
Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics
Recent advances in structural biology of bacterial transporters provide valuable templates for modeling. The crystal structures of bacterial peptide transporters have revealed common architectural features and substrate binding mechanisms that can inform models of BRA1093/BS1330_II1085 .
For functional validation of structural models, researchers should prioritize conserved residues identified through multiple sequence alignments with functionally characterized transporters. Mutations that disrupt transport function while maintaining protein expression and membrane localization can provide strong evidence for the structural importance of specific residues or domains.
Understanding BRA1093/BS1330_II1085 within the broader context of Brucella metabolism requires integrative systems biology approaches that connect transport function to bacterial physiology:
Metabolomic Analysis:
Compare metabolite profiles between wild-type and BRA1093/BS1330_II1085 mutant strains
Identify metabolic pathways dependent on BRA1093/BS1330_II1085-mediated transport
Trace isotope-labeled peptide substrates to map their metabolic fate
Interactome Analysis:
Identify protein-protein interactions through pull-down assays or bacterial two-hybrid systems
Map the complete transport complex including associated ATP-binding proteins
Identify regulatory proteins that modulate transporter activity
Predictive Metabolic Modeling:
Incorporate transport kinetics into genome-scale metabolic models
Predict growth phenotypes under various nutrient conditions
Identify potential metabolic vulnerabilities for therapeutic targeting
Studies of peptide transporters in other organisms demonstrate the value of integrative approaches. For example, comprehensive analysis of the yeast peptide transporter Ptr2p combined substrate specificity data with computational modeling to achieve 97% accuracy in predicting ligand affinities . Similar approaches could reveal how BRA1093/BS1330_II1085 contributes to Brucella metabolism and virulence.
The interconnection between transport systems and bacterial physiology is particularly relevant for intracellular pathogens like Brucella suis, which must adapt to nutrient-limited environments within host cells. Transporters with substrate multispecificity provide metabolic flexibility that may be critical for survival under changing environmental conditions.