Recombinant Brucella suis biovar 1 Putative zinc metalloprotease BR1156/BS1330_I1152 (BR1156, BS1330_I1152)

What is Recombinant Brucella suis biovar 1 Putative zinc metalloprotease BR1156/BS1330_I1152?

Recombinant Brucella suis biovar 1 Putative zinc metalloprotease BR1156/BS1330_I1152 is a bacterial enzyme belonging to the metalloendopeptidase family (EC 3.4.24.-) derived from Brucella suis biovar 1 strain 1330. This protein is identified in UniProt database as Q8G0E1 and is encoded by the BR1156 and BS1330_I1152 loci. The full-length protein consists of 379 amino acids with the complete sequence: MQEALALFFGSESLLVGTIIPFLFVLTVVVFVHEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSSPVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPLIAGVQPGSPAAEAGFEPGDRFVSVEGEKIT TFADVQRIVSGRAGDKLNFTVERDGKMVDLQAVPKIVERTDPLGNKVKLGAIGVETTEAVGNFRRIEYGPLESVGQAVIETGHIIGRTGEFFKRFAVGREDKCQLGGPVKIATMASKAA SQGFDWLIQLMAMLSIGIGL LNLFPLPPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLFAC .

What is the hypothesized functional role of zinc metalloproteases in Brucella suis pathogenesis?

Zinc metalloproteases in Brucella species likely play crucial roles in virulence and host-pathogen interactions. Based on research in related Brucella species, these enzymes may contribute to:

• Bacterial invasion and intracellular survival within host cells

• Evasion of host immune responses through degradation of immune effector molecules

• Acquisition of essential nutrients during infection

• Regulation of bacterial zinc homeostasis, which has been demonstrated as essential for Brucella virulence

Research on B. abortus has established that precise zinc homeostasis coordination is critical for pathogenesis, with disruption of zinc regulatory systems leading to attenuation of virulence in infection models . As a putative zinc metalloprotease, BR1156/BS1330_I1152 likely contributes to these pathogenic mechanisms, though specific functions require further investigation through targeted experimental approaches.

What are the proper storage and handling conditions for this recombinant protein?

For optimal stability and activity of Recombinant Brucella suis biovar 1 Putative zinc metalloprotease BR1156/BS1330_I1152, the following storage and handling protocols are recommended:

Researchers should avoid repeated freeze-thaw cycles as these can compromise protein integrity and enzymatic activity. For experimental work, it is advisable to prepare small working aliquots that can be stored at 4°C for up to one week . The recombinant protein is typically provided in a Tris-based buffer containing 50% glycerol, which helps maintain stability during storage.

What expression systems are optimal for producing recombinant BR1156/BS1330_I1152?

When designing expression systems for recombinant BR1156/BS1330_I1152, researchers should consider several factors that influence protein yield, folding, and activity:

For BR1156/BS1330_I1152, which contains both transmembrane and catalytic domains, expression strategies should address the membrane-associated nature of this protein. Truncated constructs focusing on the catalytic domain may provide better solubility and activity for initial functional studies.

How can I verify the enzymatic activity of recombinant BR1156/BS1330_I1152?

Verification of enzymatic activity for BR1156/BS1330_I1152 requires multiple complementary approaches:

• Substrate hydrolysis assays: Using synthetic peptide substrates containing FRET (Fluorescence Resonance Energy Transfer) pairs that emit fluorescence upon cleavage. Initial screening should employ diverse peptide sequences to identify preferred substrates.

• Zymography: Incorporate potential protein substrates into polyacrylamide gels to visualize proteolytic activity as clear zones against a stained background.

• Inhibitor profiling: Test sensitivity to various metalloprotease inhibitors (e.g., EDTA, 1,10-phenanthroline) to confirm zinc dependency, and compare with more specific inhibitors to characterize the active site.

• Metal dependency assays: Compare activity with different divalent cations (Zn²⁺, Cu²⁺, Ni²⁺) to confirm specificity for zinc, as proper metalloprotease function typically requires zinc specifically in the active site.

Validation should include positive controls using well-characterized metalloproteases and negative controls using both heat-inactivated BR1156/BS1330_I1152 and site-directed mutants with alterations to the predicted catalytic residues.

What cell models are most appropriate for studying BR1156/BS1330_I1152 in vitro?

Selection of appropriate cell models for studying BR1156/BS1330_I1152 function should reflect its natural context in Brucella suis pathogenesis:

• Macrophage cell lines (RAW264.7, J774A.1, THP-1): These represent primary host cells for Brucella infection and are essential for studying metalloprotease roles in intracellular survival and immune evasion.

• Epithelial cell lines (HeLa, Vero): Useful for investigating bacterial invasion mechanisms and potential metalloprotease contributions to cellular entry.

• Primary cells: Porcine alveolar macrophages or peripheral blood monocytes provide more physiologically relevant models, particularly since pigs are natural hosts for B. suis biovar 1 .

• Trophoblast cell lines: Important for studying reproductive pathogenesis, as brucellosis frequently causes reproductive complications including abortions .

Each model should be selected based on the specific aspect of BR1156/BS1330_I1152 function being investigated. For studying zinc homeostasis interactions, cell models must be maintained in media with carefully controlled zinc concentrations to prevent experimental artifacts.

How does BR1156/BS1330_I1152 potentially contribute to zinc homeostasis in Brucella suis?

Based on research in related Brucella species, zinc homeostasis is tightly regulated through coordinated expression of zinc importers, exporters, and regulatory proteins. While the specific role of BR1156/BS1330_I1152 in this system remains to be fully characterized, several mechanisms can be hypothesized and experimentally tested:

• The putative zinc metalloprotease BR1156/BS1330_I1152 may function as part of a regulatory circuit controlling zinc uptake or export proteins. In B. abortus, the ZnuABC system controls zinc import while ZntA mediates export, both under control of specific regulatory proteins (Zur and ZntR, respectively) .

• BR1156/BS1330_I1152 might process zinc-binding proteins, thereby contributing to zinc redistribution within the bacterial cell or sequestration during host infection.

• The enzyme could potentially degrade host zinc-binding proteins during infection, liberating zinc for bacterial use in nutrient-limited intracellular environments.

Experimental approaches to investigate these hypotheses should include:

• Comparative proteomics in wild-type vs. BR1156/BS1330_I1152 knockout strains under varying zinc concentrations

• Transcriptional analysis of zinc homeostasis genes in response to BR1156/BS1330_I1152 expression levels

• Zinc-specific fluorescent probes to track intracellular zinc distribution in the presence/absence of active BR1156/BS1330_I1152

Research in B. abortus has demonstrated that disruption of zinc homeostasis significantly attenuates virulence , suggesting that BR1156/BS1330_I1152 may similarly impact B. suis pathogenicity through zinc-related mechanisms.

What methodological approaches can resolve contradictory data about BR1156/BS1330_I1152 function?

When facing contradictory experimental results regarding BR1156/BS1330_I1152 function, researchers should implement a systematic troubleshooting approach:

• Standardize experimental conditions: Ensure consistent protein preparations, buffer compositions, and zinc concentrations across experiments. Minor variations in zinc availability can significantly alter metalloprotease activity.

• Employ multiple complementary techniques:

  • Biochemical assays (enzyme kinetics, substrate profiling)

  • Structural approaches (X-ray crystallography, cryo-EM)

  • Genetic approaches (knockout, knockdown, complementation)

  • In vivo infection models with physiologically relevant endpoints

• Systematic review methodology: Apply structured approaches to evaluate contradictory literature following established systematic review protocols :

  • Define precise inclusion/exclusion criteria

  • Extract data using standardized forms

  • Assess study quality using validated tools

  • Perform meta-analysis where appropriate

• Control for batch effects: Different recombinant protein preparations may vary in activity. Use internal controls and standardized reference materials to normalize results across experiments.

• Validate antibody specificity: If using antibody-based detection methods, validate specificity through multiple approaches including western blotting against recombinant protein and knockout controls.

This multi-faceted approach allows researchers to identify sources of variation and determine which results most accurately reflect the true biological function of BR1156/BS1330_I1152.

How can structural analysis of BR1156/BS1330_I1152 inform drug design strategies?

Structural characterization of BR1156/BS1330_I1152 provides critical insights for rational drug design targeting Brucella suis infections:

• Active site mapping: Identifying the zinc-coordinating residues and substrate-binding pocket can guide design of competitive inhibitors. The amino acid sequence suggests a metalloprotease fold with potential zinc-coordinating histidines and glutamate/aspartate residues .

• Allosteric site identification: Beyond the active site, allosteric regulatory sites may offer opportunities for selective inhibition without cross-reactivity with host metalloproteases.

• Structure-based virtual screening: Once the three-dimensional structure is determined, virtual screening of compound libraries can identify potential inhibitors with appropriate physicochemical properties.

• Fragment-based drug design: This approach can develop high-affinity inhibitors by identifying small molecular fragments that bind to different regions of the protein and then linking them to create potent, selective compounds.

• Crystallization strategies:

  • Co-crystallization with inhibitors or substrate analogs

  • Introduction of surface mutations to enhance crystal packing

  • Use of antibody fragments to stabilize flexible regions

The membrane-associated nature of BR1156/BS1330_I1152 presents challenges for structural studies. Truncation constructs focusing on the soluble catalytic domain may facilitate initial crystallization efforts, though care must be taken to ensure that the truncated protein retains native folding and activity.

How can BR1156/BS1330_I1152 research contribute to brucellosis vaccine development?

Research on BR1156/BS1330_I1152 has significant implications for brucellosis vaccine development through several potential mechanisms:

• Attenuated strain development: Targeted modification of BR1156/BS1330_I1152 could generate attenuated B. suis strains that maintain immunogenicity while reducing virulence. Similar approaches targeting zinc homeostasis systems in B. abortus have demonstrated attenuation in animal models .

• Subunit vaccine design: If BR1156/BS1330_I1152 proves immunogenic, the recombinant protein itself could serve as a component in subunit vaccines, particularly if it elicits protective antibody or T-cell responses.

• Adjuvant development: Metalloproteases can generate immunostimulatory peptides through their proteolytic activity. Engineered variants of BR1156/BS1330_I1152 might generate specific peptide patterns that enhance vaccine efficacy.

• Cross-protection assessment: Determining sequence and structural conservation of BR1156/BS1330_I1152 across Brucella species could identify conserved epitopes for vaccines offering broader protection against multiple Brucella species.

Experimental approaches should include:

• Immunization studies using both wild-type and catalytically inactive mutants

• Epitope mapping to identify immunodominant regions

• Challenge studies in appropriate animal models (mice for initial screening, pigs for host-specific validation)

• Correlation of protection with specific immune parameters (antibody titers, cellular responses)

What diagnostic applications might emerge from BR1156/BS1330_I1152 research?

BR1156/BS1330_I1152 research could enhance brucellosis diagnostic capabilities through several innovative approaches:

• Serological diagnostics: If BR1156/BS1330_I1152 elicits specific antibody responses during natural infection, recombinant protein could serve as an antigen in ELISA or other immunoassay formats. Current serological tests for B. suis include rose bengal test, serum tube agglutination test, microagglutination test, and various immunocapture assays .

• Molecular diagnostics: PCR primers targeting BR1156/BS1330_I1152 gene sequences could provide species or biovar-specific detection of B. suis. This approach could complement current molecular diagnostic methods that may not distinguish between Brucella species or biovars.

• Activity-based probes: Development of specific substrates for BR1156/BS1330_I1152 could enable activity-based detection in clinical samples, potentially offering improved sensitivity over current methods.

• Point-of-care testing: Antibody-based lateral flow assays using recombinant BR1156/BS1330_I1152 could facilitate field diagnosis, particularly important for regions with limited laboratory infrastructure.

Diagnostic test development should address cross-reactivity concerns, as serological tests for Brucella species can cross-react with other pathogens including Yersinia enterocolitica O:9, Salmonella urbana group N, Leptospira sp., Vibrio cholerae, Francisella tularensis, E. coli O157, and Stenotrophomonas maltophilia .

How does inhibition of BR1156/BS1330_I1152 affect Brucella suis survival in host cells?

Understanding the impact of BR1156/BS1330_I1152 inhibition on B. suis intracellular survival requires methodical investigation using complementary approaches:

• Genetic inhibition strategies:

  • Generation of precise gene knockout mutants using homologous recombination

  • Inducible knockdown systems to control expression levels

  • Dominant negative mutants expressing catalytically inactive variants

• Chemical inhibition approaches:

  • Metalloprotease inhibitors with varying specificity profiles

  • Novel inhibitors identified through structural studies

  • Time-course experiments with inhibitor addition at different infection stages

• Cellular infection models:

  • Macrophage survival assays (CFU determination at multiple timepoints)

  • Confocal microscopy to track intracellular trafficking

  • Co-localization studies with markers for different endocytic compartments

• Mechanistic investigations:

  • Transcriptomic analysis of host response to wild-type vs. inhibited bacteria

  • Phosphoproteomic analysis of signaling pathways affected by BR1156/BS1330_I1152

  • Cytokine profiling to assess immunomodulatory effects

Studies should examine both early (invasion, phagosome trafficking) and late (replication, persistence) stages of infection, as the metalloprotease may play distinct roles at different phases. Research on related Brucella species suggests that proper coordination of zinc homeostasis systems, potentially including metalloproteases like BR1156/BS1330_I1152, is essential for virulence in mouse models of infection .