Recombinant Brucella suis biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Brucella suis biovar 1 sn-glycerol-3-phosphate transport system permease protein UgpA (UgpA) is a prokaryotic transmembrane protein involved in the uptake of sn-glycerol-3-phosphate (G3P), a critical metabolite for bacterial phospholipid synthesis and energy metabolism. This protein is part of the ATP-binding cassette (ABC) transporter system, which facilitates the import of G3P across the cytoplasmic membrane . The recombinant form is produced via in vitro expression systems, enabling its study and application in diagnostics, immunology, and vaccine development .

Role in Brucella Pathogenicity

  • ABC transporters, including UgpA, are critical for nutrient acquisition in Brucella species, enabling survival in host cells .

  • Brucella ABC systems are enriched for nutrient importers (e.g., oligopeptides, monosaccharides, polyols), with UgpA classified under the OTCN (osmoprotectants, taurine, cyanate, nitrate) family .

Immunogenicity and Vaccine Development

Comparative Analysis of UgpA Across Brucella Species

SpeciesBiovarGene IDHost SpecificityFunctional Role
B. suis1Q8FW09 Swine, humansG3P transport, virulence
B. abortus1BAB_RS29115CattleNutrient import
B. melitensis1BMEI1742Goats, sheepVirulence factor
B. ovisN/A-SheepAbsent in human-pathogenic strains

Available Recombinant UgpA Variants

Product IDSpeciesHost SystemPuritySource
MBS7032764 B. suis biovar 1Cell-free expression≥85%MyBioSource
MBS7032758 B. suis biovar 1Cell-free expression≥85%MyBioSource
RFL12039BF B. suis biovar 1E. coli≥85%Creative Biomart

Functional Classification of Brucella ABC Transporters

ClassFamilySubstrates TransportedRole in Pathogenicity
1ExportLipoproteins, antibioticsEfflux, toxin resistance
2HousekeepingDNA repair, cell divisionMetabolic maintenance
3ImportG3P, oligopeptides, sugarsNutrient acquisition

Implications for Future Research

  • Mechanistic Studies: Elucidate UgpA’s role in B. suis survival within macrophages and its interaction with host receptors (e.g., CXCR4) .

  • Vaccine Development: Explore UgpA as a subunit antigen or component of outer membrane vesicles (OMVs) for mucosal immunization .

  • Diagnostics: Develop serological assays using recombinant UgpA to differentiate infected from vaccinated animals (DIVA) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ugpA; BRA0656; BS1330_II0650; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
ugpA
Target Protein Sequence
MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDAFGLKSTFVELANFTAV LSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAVA GMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAAAWKQISYNFLFFVAGLQ AIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGGP AKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex UgpABCE, involved in the import of sn-glycerol-3-phosphate. It is likely responsible for substrate translocation across the membrane.
Database Links

KEGG: bms:BRA0656

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UgpA protein and what is its role in Brucella suis biovar 1?

UgpA is a permease protein component of the sn-glycerol-3-phosphate (G3P) transport system in Brucella suis biovar 1. It functions as part of a binding protein-dependent transport complex that facilitates the uptake of G3P across the bacterial cell membrane. The ugp-dependent transport system is typically induced under phosphate starvation conditions and is part of the pho regulon . In Brucella and related intracellular pathogens, this transport system is particularly important as it allows bacteria to acquire essential nutrients within the limiting environment of host cells. The UgpA protein spans the cell membrane multiple times and forms a channel through which the substrate can pass after initial binding to the periplasmic binding protein component of the system.

How is the ugp transport system regulated in bacteria?

The ugp transport system is primarily regulated in response to phosphate availability. It is induced under conditions of phosphate starvation and in mutants that constitutively express the pho regulon . This regulation ensures that bacteria can utilize alternative phosphate sources when inorganic phosphate is limited. The system consists of multiple components including a periplasmic binding protein that initially captures the substrate, and membrane-associated components like UgpA that facilitate transport across the membrane. Experimental evidence shows that the binding protein is necessary but not sufficient for transport activity, indicating the essential role of permease proteins like UgpA in the functional transport system . In the context of Brucella infection, this regulated transport system may be crucial for bacterial survival within phosphate-limited intracellular compartments.

What are the best methods for cloning and expressing recombinant ugpA protein?

When cloning and expressing the recombinant ugpA protein from Brucella suis biovar 1, several considerations must be addressed due to its nature as a membrane protein. The recommended methodology involves:

  • Gene Amplification: Design primers that include appropriate restriction sites based on your expression vector. For Brucella genes, codon optimization may improve expression in common laboratory hosts like E. coli.

  • Expression System Selection: Membrane proteins like UgpA often require specialized expression systems. E. coli strains like C41(DE3) or C43(DE3), which are engineered for membrane protein expression, are generally preferable. Alternatively, cell-free protein synthesis systems may be used for difficult-to-express membrane proteins.

  • Fusion Tags: Consider adding a purification tag (His6, FLAG, etc.) separated by a TEV protease cleavage site to facilitate purification. For membrane proteins, adding a fusion partner like GFP can help monitor expression and proper folding.

  • Expression Conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the yield of correctly folded membrane proteins. Use Western blotting with anti-tag antibodies to confirm expression.

  • Extraction and Purification: Use mild detergents (DDM, LDAO) for solubilization, followed by affinity chromatography and size exclusion chromatography. The choice of detergent is critical for maintaining protein function.

This methodological approach has been successfully applied to other bacterial membrane transport proteins and can be adapted for Brucella ugpA.

How can I verify the functionality of recombinant ugpA protein in vitro?

Verifying the functionality of recombinant UgpA requires demonstration of its transport activity, which can be challenging for membrane proteins. A comprehensive approach includes:

  • Reconstitution into Liposomes: Purified UgpA should be incorporated into liposomes along with other components of the ugp transport system. This reconstitution is necessary because UgpA is part of a multicomponent transport system that requires a periplasmic binding protein .

  • Transport Assays: Measure the uptake of radiolabeled sn-glycerol-3-phosphate into proteoliposomes. The transport activity should show characteristics consistent with the native system, including dependence on the binding protein and sensitivity to known inhibitors.

  • Substrate Binding Assays: Although UgpA itself may not directly bind the substrate, interaction studies with the binding protein component can verify proper complex formation.

  • ATPase Activity Assays: If the ugp system is ATP-dependent, measuring ATP hydrolysis in response to substrate addition can indicate functional coupling.

  • Structural Integrity Assessment: Circular dichroism spectroscopy can confirm proper secondary structure formation, while fluorescence-based thermal shift assays can assess protein stability.

It's important to note that the ugp transport system does not function in membrane vesicles and requires the periplasmic binding protein component, making functional reconstitution particularly challenging but essential for verification .

What cell models are appropriate for studying ugpA function in Brucella infection?

Several cell models can be employed to study ugpA function in the context of Brucella infection:

  • Macrophage Cell Lines: Since Brucella suis replicates within macrophages , cell lines such as RAW264.7 (murine) or THP-1 (human) provide relevant models. These cells can be infected with wild-type and ugpA-mutant Brucella to assess the role of ugpA in intracellular survival and replication.

  • Primary Macrophages: These offer a more physiologically relevant environment than cell lines. Bone marrow-derived macrophages (BMDMs) from mice or peripheral blood monocyte-derived macrophages from humans provide excellent models for studying host-pathogen interactions.

  • Trophoblast Cell Lines: For studying B. suis infection in reproductive tissues, trophoblast cell lines may be appropriate, especially when investigating tissue-specific aspects of infection.

  • Three-dimensional Tissue Models: These advanced models better recapitulate the complex environment encountered by Brucella in vivo and may reveal aspects of ugpA function not apparent in monolayer cultures.

  • Mouse Models: For in vivo studies, mice serve as a well-established animal model for brucellosis . Comparison of infections with wild-type and ugpA-mutant strains can reveal the importance of this transport system in pathogenesis.

When using these models, researchers should monitor bacterial internalization, intracellular trafficking, replication rates, and host cell responses to determine how UgpA contributes to the infection process.

What approaches can be used to study the structure-function relationship of ugpA?

Understanding the structure-function relationship of UgpA requires a multidisciplinary approach:

  • Computational Structural Prediction: Homology modeling based on related transporters can provide initial structural insights. AlphaFold2 and similar AI-based prediction tools have significantly improved membrane protein structure prediction.

  • Site-directed Mutagenesis: Systematic mutation of conserved residues, particularly those predicted to line the transport channel or interact with other system components, can identify functionally important regions. Each mutant should be assessed for expression, localization, and transport activity.

  • Cysteine Scanning Mutagenesis: This approach involves introducing cysteine residues at specific positions and using sulfhydryl-reactive compounds to probe accessibility, providing information about the topology and dynamic regions of the protein.

  • Cross-linking Studies: Chemical cross-linking combined with mass spectrometry can identify interaction interfaces between UgpA and other components of the transport system.

  • Structural Biology Techniques: X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy (for specific domains) can provide high-resolution structural information. These approaches are challenging for membrane proteins but have become more accessible with technological advances.

  • Molecular Dynamics Simulations: These can provide insights into conformational changes during the transport cycle, complementing experimental structural data.

By integrating these approaches, researchers can develop a comprehensive understanding of how UgpA structure relates to its function in sn-glycerol-3-phosphate transport.

How does ugpA contribute to Brucella suis survival within macrophages?

UgpA likely plays a critical role in B. suis survival within macrophages through several mechanisms:

  • Nutrient Acquisition: Within the macrophage phagosome, Brucella faces nutrient limitation as part of the host defense strategy. The ugp transport system enables bacteria to utilize sn-glycerol-3-phosphate as a phosphate source when inorganic phosphate is limited , potentially supporting bacterial metabolism during intracellular residence.

  • Adaptation to Phagosomal Environment: Brucella species are known to resist killing by neutrophils following phagocytosis and can replicate inside macrophages . The ability to transport essential nutrients like phosphate-containing compounds via UgpA may be critical for this adaptation.

  • Integration with Metabolic Pathways: In conditions where alternate carbon sources are available, sn-glycerol-3-phosphate transported by the ugp system can be incorporated into phospholipids and other cellular components , supporting bacterial membrane integrity and replication within the host cell.

  • Response to Stress Conditions: The ugp system is induced under phosphate starvation , suggesting it forms part of the bacterial stress response. This induction may enable Brucella to adapt to changing conditions within the macrophage during infection progression.

Understanding UgpA's contribution to intracellular survival requires studying ugpA-deficient mutants in macrophage infection models, assessing bacterial replication rates, and analyzing metabolite utilization during infection.

What is the role of ugpA in phosphate acquisition during Brucella infection?

The role of UgpA in phosphate acquisition during Brucella infection can be understood through several key aspects:

  • Alternative Phosphate Source Utilization: The ugp transport system allows bacteria to use sn-glycerol-3-phosphate as a phosphate source when inorganic phosphate is limited . This capability may be crucial during infection as host cells can restrict phosphate availability as an antimicrobial strategy.

  • Integration with Phosphate Regulation Networks: The ugp system is induced under phosphate starvation and in mutants constitutive for the pho regulon , indicating its integration with broader phosphate homeostasis mechanisms in the bacterium.

  • Contribution to Metabolic Flexibility: Research shows that sn-glycerol-3-phosphate transported via the ugp system can be incorporated into phospholipids and other cellular components . This metabolic flexibility may help Brucella adapt to changing nutrient availability during different stages of infection.

  • Potential Impact on Virulence: While direct evidence linking UgpA to Brucella virulence is limited in the provided sources, nutrient acquisition systems often contribute to pathogen virulence. The ability to maintain phosphate homeostasis is likely essential for Brucella's intracellular lifestyle and consequent pathogenicity.

To fully characterize UgpA's role in phosphate acquisition, researchers should employ isotope labeling studies to track phosphate incorporation from sn-glycerol-3-phosphate during infection and analyze the phosphate-dependent transcriptional response in wild-type versus ugpA-mutant strains.

How can ugpA be targeted for potential vaccine or therapeutic development?

Targeting UgpA for vaccine or therapeutic development presents several strategic opportunities:

  • Attenuated Vaccine Strains: Creating ugpA deletion mutants may produce attenuated Brucella strains useful as live vaccines. Similar approaches with other genes have shown promise; for example, B. abortus glycosyltransferase (wboA) deletion mutants showed attenuation while maintaining immunogenicity .

  • Subunit Vaccine Components: Recombinant UgpA or immunogenic epitopes from the protein could be included in subunit vaccine formulations. Since UgpA is a membrane protein with extracellular domains, these regions might elicit protective antibody responses that inhibit nutrient acquisition.

  • Transport Inhibitors: Small molecule inhibitors of UgpA function could starve intracellular Brucella of essential nutrients. The selective targeting of bacterial transporters not present in mammals offers potential therapeutic specificity.

  • Adjuvant Systems: Understanding UgpA's role in bacterial metabolism might inform the development of adjuvants that modulate host-pathogen metabolic interactions to enhance immune responses against Brucella.

  • Diagnostic Applications: Recombinant UgpA could be used in serological tests for brucellosis diagnosis, potentially offering advantages over current agglutination tests .

Development of these approaches requires detailed understanding of UgpA structure, function, and immunogenicity, as well as thorough evaluation in appropriate animal models before clinical translation.

What are the challenges in studying membrane proteins like ugpA in Brucella?

Studying membrane proteins like UgpA in Brucella presents several significant challenges:

Researchers can address these challenges through heterologous expression in specialized systems, careful optimization of purification conditions, and collaborative approaches leveraging complementary expertise and facilities.

How do I analyze transport kinetics data for ugpA-mediated sn-glycerol-3-phosphate uptake?

Analysis of transport kinetics data for UgpA-mediated sn-glycerol-3-phosphate uptake requires systematic approaches to extract meaningful parameters:

Table 1: Key Parameters for Analyzing UgpA-Mediated Transport

ParameterTypical RangeExperimental ApproachSignificance
Km0.1-10 μMConcentration-dependent uptakeSubstrate affinity
Vmax0.5-50 nmol/min/mg proteinConcentration-dependent uptakeMaximum transport capacity
Temperature dependenceEa = 30-60 kJ/molArrhenius plotEnergy barriers in transport cycle
pH dependencepH optimum typically 6.5-7.5pH-dependent uptakeProton coupling and protein stability
Binding protein Kd0.01-1 μMFluorescence-based binding assaysInitial substrate recognition

Data should be analyzed using nonlinear regression rather than linearization methods (like Lineweaver-Burk plots) for more accurate parameter estimation, particularly when working with systems showing complex kinetics.

What statistical approaches are recommended for comparing ugpA expression under different conditions?

When comparing UgpA expression under different experimental conditions, appropriate statistical approaches are essential:

  • Experimental Design Considerations:

    • Include at least 3-5 biological replicates per condition

    • Consider appropriate controls (positive, negative, housekeeping genes)

    • Account for batch effects through randomization and blocking designs

  • Normalization Strategies:

    • For qRT-PCR: Use multiple reference genes (e.g., 16S rRNA and rpoB) for normalization

    • For proteomics: Total protein normalization or spike-in standards are recommended

    • For Western blots: Normalize to loading controls like total protein stain rather than single housekeeping proteins

  • Statistical Tests Based on Data Characteristics:

    • For normally distributed data: t-test (two conditions) or ANOVA with post-hoc tests (multiple conditions)

    • For non-normally distributed data: Mann-Whitney U test or Kruskal-Wallis with appropriate post-hoc tests

    • For time-series or concentration-response data: Repeated measures ANOVA or mixed-effects models

  • Multiple Testing Correction:

    • When comparing expression across multiple conditions or genes, apply false discovery rate (FDR) correction (e.g., Benjamini-Hochberg procedure)

    • Report both raw and adjusted p-values for transparency

  • Effect Size Calculation:

    • Report fold changes with confidence intervals

    • Calculate Cohen's d or similar metrics to quantify the magnitude of differences

Table 2: Statistical Analysis Framework for UgpA Expression Studies

Expression MethodNormalization ApproachStatistical TestSample Size Recommendation
qRT-PCRMultiple reference genes (ΔΔCt)ANOVA with Tukey's post-hocn ≥ 3 biological replicates
Western BlotTotal protein normalizationNon-parametric tests (Mann-Whitney)n ≥ 5 biological replicates
ProteomicsGlobal normalization methodsLimma or DESeq2-like approachesn ≥ 4 biological replicates
Reporter FusionOD-normalized fluorescenceMixed-effects modelsn ≥ 3 biological replicates

This systematic approach ensures robust statistical inference when comparing ugpA expression across different experimental conditions, such as nutrient availability or infection states.

How should I interpret contradictory results regarding ugpA function?

When facing contradictory results regarding UgpA function, systematic evaluation is necessary:

  • Methodological Differences Assessment:

    • Examine differences in experimental systems (e.g., in vitro reconstitution vs. cellular models)

    • Compare strain backgrounds, as genetic differences between Brucella strains might affect results

    • Assess whether complete transport complexes were studied, as UgpA functions as part of a multicomponent system

  • Experimental Condition Variations:

    • Phosphate availability significantly affects ugp system expression and function

    • The presence of alternative carbon sources influences sn-glycerol-3-phosphate utilization

    • Growth phase and stress conditions may alter transport system activity

  • Technical Considerations:

    • Evaluate protein expression levels and proper membrane localization

    • Consider the sensitivity and specificity of detection methods

    • Assess whether appropriate controls were included

  • Reconciliation Strategies:

    • Develop unified models that accommodate seemingly contradictory observations

    • Design experiments that directly test competing hypotheses

    • Consider complementary approaches (genetic, biochemical, structural) to resolve discrepancies

  • Publication Bias Awareness:

    • Negative results regarding UgpA function may be underreported

    • Consider running meta-analyses when sufficient literature exists

Table 3: Framework for Resolving Contradictory UgpA Function Results

Contradiction TypePossible ExplanationResolution Approach
Activity in different strainsGenetic background effects or variations in ugpA sequenceComparative genomics and complementation studies
In vitro vs. in vivo resultsMissing cofactors or interacting partnersReconstitution with complete system components
Substrate specificity discrepanciesAssay conditions or detection methodsStandardized transport assays with multiple detection methods
Phenotypic effects of mutationsPolar effects or compensatory mechanismsClean deletion and complementation analysis
Localization differencesExpression level artifacts or tagging effectsMultiple localization methods with native expression levels

By systematically evaluating contradictory results through this framework, researchers can develop a more comprehensive understanding of UgpA function in Brucella suis.

What bioinformatic tools are useful for analyzing ugpA homologs across bacterial species?

Bioinformatic analysis of UgpA homologs across bacterial species requires specialized tools for membrane proteins:

  • Sequence Analysis Tools:

    • BLAST and PSI-BLAST for initial homolog identification

    • HMMER for profile-based searches of distant homologs

    • MEGA or MrBayes for phylogenetic analysis of evolutionary relationships

    • CLANS for clustering analysis of transporter superfamilies

  • Membrane Protein-Specific Tools:

    • TMHMM, HMMTOP, or Phobius for transmembrane topology prediction

    • TOPCONS for consensus topology predictions

    • MEMSAT-SVM for topology with functional region prediction

    • SignalP for signal peptide detection

  • Comparative Genomics Approaches:

    • Gene neighborhood analysis using tools like SyntTax or GeConT

    • Analysis of conserved gene clusters via MicrobesOnline or IMG

    • Identification of horizontally transferred regions using IslandViewer

  • Structural Prediction Tools:

    • AlphaFold2 for protein structure prediction

    • RaptorX for template-based modeling

    • SWISS-MODEL for homology modeling

    • ConSurf for mapping conservation onto structural models

  • Function Prediction Resources:

    • InterProScan for functional domain identification

    • Transporter Classification Database (TCDB) for transport system classification

    • KEGG and BioCyc for metabolic pathway integration

Table 4: Recommended Bioinformatic Tools for UgpA Analysis

Analysis TypeRecommended ToolsKey FeaturesOutput Format
Homolog IdentificationHHpred, JackHMMERSensitive detection of remote homologsMultiple sequence alignments
Topology PredictionMEMSAT-SVM, TOPCONSConsensus approach for membrane proteinsTransmembrane helix maps
Structural ModelingAlphaFold2, RoseTTAFoldAI-based structure predictionPDB format 3D models
Conservation AnalysisConSurf, Evolutionary TraceMaps conservation to structureConservation scores
Genomic ContextSyntTax, MicrobesOnlineIdentifies conserved gene neighborhoodsGene cluster visualizations

When analyzing UgpA homologs, it's important to consider that average nucleotide identity within Brucella species is very high (>99.7%) , so detecting meaningful variation requires sensitive approaches. For comparison across more diverse bacteria, transport system classification and functional prediction should be emphasized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.