Recombinant Brucella suis biovar 1 Type IV secretion system protein virB3 (virB3)

What is the structure and function of virB3 protein in Brucella suis?

virB3 is a component of the Type IV secretion system (T4SS) in Brucella suis, comprising 116 amino acids. The protein's amino acid sequence is: MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES .

virB3 functions as an integral membrane component of the T4SS machinery, which is essential for intracellular survival and replication of Brucella. This protein is part of the virB operon located on chromosome 2, which encodes the complete T4SS apparatus . While specific structural data for Brucella virB3 is limited, cross-linking studies indicate it forms specific protein-protein interactions within the T4SS complex similar to other bacterial T4SS systems .

How is the virB operon organized and regulated in Brucella suis?

The virB operon in Brucella suis consists of 12 open reading frames (ORFs) located on the SpeI fragment of chromosome 2. These genes (virB1-virB12) form a single transcriptional unit . Reverse transcriptase-PCR studies have confirmed that all 12 genes encoding the B. suis VirB system form an operon .

Regulation occurs through environmental signals, particularly during intracellular infection. Flow cytometry and fluorescence microscopy studies demonstrate that the virB promoter is induced in macrophages within 3 hours after infection. This induction only occurs once bacteria are inside cells, with phagosome acidification serving as the major signal for intracellular expression . This acidification is essential for Brucella's intracellular multiplication, triggering the secretion of effector molecules that remodel the phagosome into a replication-permissive compartment .

What expression systems are most effective for producing recombinant virB3 protein?

Several expression systems have been documented for recombinant virB3 production:

For Brucella suis biovar 1 virB3 specifically, E. coli expression with N-terminal His-tag fusion has been validated, producing full-length protein (aa 1-116) with >90% purity as determined by SDS-PAGE .

Recommended storage: Store lyophilized protein at -20°C/-80°C, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol for long-term storage. Avoid repeated freeze-thaw cycles .

How does virB3 contribute to the Type IV secretion system assembly and function?

virB3 is an essential component of the T4SS transmembrane complex. Research using heterologous expression of the B. suis virB operon in Agrobacterium tumefaciens has shown that virB3 assembles with other VirB proteins in the bacterial membrane . Cross-linking studies indicate protein-protein interactions similar to those observed in other T4SS systems, with immunofluorescence analysis confirming the formation of VirB protein complexes in the cell envelope .

The VirB T4SS is activated rapidly during intracellular infection, reaching maximum activity within five hours. Once the replication niche is established, VirB T4SS activity is inhibited . The system functions by:

• Secreting effector molecules that subvert cellular pathways

• Mediating biogenesis of the endoplasmic reticulum (ER)-derived replicative Brucella-containing vacuole (rBCV)

• Supporting intracellular survival and replication

• Contributing to persistent infection by modulating host immune responses

Experiments with non-polar mutations in various virB genes have demonstrated differential effects on virulence. While VirB2 plays a crucial role in continuous infection of mice, VirB1 appears dispensable for this process .

What methodologies are most effective for studying virB3 function in cellular infection models?

Several validated approaches exist for studying virB3 function:

1. Transposon mutagenesis:

• Signature-tagged transposon mutagenesis has been successfully applied to create virB3 mutants for functional analysis

• Protocol involves using mini-Tn5 Km2 transposon insertion followed by selective screening in macrophage infection models

2. Cell infection models:

• Human THP-1 macrophages differentiated with vitamin D3 provide a reliable model

• Dendritic cells (DCs) offer an alternative model, with infection rates of approximately 29.6% ± 2.6%

• HeLa cells can be used for non-professional phagocyte studies

3. Fluorescence microscopy techniques:

• Green fluorescent protein (GFP) reporter constructs with the virB promoter enable visualization of expression dynamics

• Fluorescence-activated cell sorting (FACS) analysis provides quantitative measurement of virB expression in infected cells

4. Intracellular trafficking analysis:

• Confocal microscopy using markers for early endosomes (EEA-1, Rab5) and late endosomes (LAMP-1, Rab7, CD63, RILP) tracks BCV maturation

• Co-localization with endoplasmic reticulum markers identifies rBCV formation

5. Heterologous expression:

• Expression in closely related α2-proteobacteria (e.g., Agrobacterium tumefaciens) allows for protein complex assembly studies outside high-containment facilities

How do virB3 mutants affect Brucella intracellular survival and host immune responses?

Mutations in virB3 and other virB operon components dramatically impact Brucella's ability to survive and replicate intracellularly:

Intracellular survival:

• virB mutants fail to establish the replicative niche within host cells

• Transposon insertion in virB genes results in avirulent phenotypes when screened in macrophage models

• The virB system is essential for rBCV formation, which provides the intracellular compartment for Brucella replication

Immune response modulation:

• While wild-type Brucella prevents dendritic cell maturation, some virB system-related mutants (particularly bvrR mutants that affect virB expression) allow DC maturation and trigger TNF-α production upon infection

• The BvrR/S two-component system regulates the expression of outer membrane proteins including those related to the virB system

• DCs infected with bvrR mutants show significantly increased expression of maturation markers including CCR7, CD83, CD40, CD86, and HLA molecules compared to wild-type infected cells

Experimental evidence of virB-dependent immune modulation:

• DCs infected with bvrR mutants demonstrate higher percentages of cells expressing CCR7 and CD83 than wild-type infected cells

• Expression levels of CD40, CD86, and HLA-ABC are higher in mutant-infected cells compared to wild-type

• The mechanism appears to involve TNF-α production, as adding anti-TNF-α antibodies significantly impairs the maturation of DCs infected with these mutants

What are the structural differences between virB3 proteins across Brucella species and other bacteria with T4SS?

The virB3 protein shows various levels of conservation across Brucella species and other bacteria with T4SS:

Within Brucella genus:

• virB3 is highly conserved across all Brucella species

• The protein length is consistently 116 amino acids in B. suis, B. abortus, and B. melitensis

• The virB operon organization (12 genes) is preserved across species

Comparison with other bacterial T4SS:

• Agrobacterium tumefaciens contains a similar virB system that functions in plant pathogenesis

• Bartonella species (including B. henselae and B. quintana) possess virB3 homologs as part of their T4SS

• Rhizobium radiobacter contains a related virB3 protein

While sequence homology exists between these systems, functional studies have revealed important differences:

• The Brucella VirB system is activated by phagosome acidification in mammalian cells

• In contrast, the A. tumefaciens VirB system is induced by plant phenolic compounds

• Despite these differences, heterologous expression of B. suis VirB proteins in A. tumefaciens has demonstrated that the proteins can assemble into a complex, suggesting structural conservation

What are the latest approaches for targeting virB3 in vaccine development strategies?

Several approaches have been developed for utilizing virB3 in vaccine research:

Recombinant protein-based vaccines:

• Purified recombinant virB3 protein can be used as a vaccine component

• These proteins can be produced with various tags (His-tag being common) to facilitate purification and analysis

• Multiple expression systems allow for optimization of protein yield and authenticity

Attenuated vaccine strains:

• virB mutants show attenuated virulence while maintaining immunogenicity

• Combined mutations (e.g., virB2::Tn5-manB) have been constructed to create defined attenuated strains

• The rough phenotype of these strains can be verified by slide agglutination with O-antigen-specific sera and acriflavin

Adjuvant considerations:

• Recombinant virB3 proteins may require appropriate adjuvants to enhance immunogenicity

• Formulation options include various buffer systems, with Tris/PBS-based buffer containing 6% trehalose at pH 8.0 being documented

Important research limitations:

• All recombinant protein products should only be used for research purposes

• These vaccine components CANNOT be used directly on humans or animals without proper clinical development

• BSL-3 containment is required for handling live Brucella strains used in vaccine development

What purification protocols yield the highest purity recombinant virB3 protein?

Optimized protocols for virB3 purification include:

Expression and purification pipeline:

• Cloning the virB3 gene (Brucella suis biovar 1) into an expression vector with His-tag

• Transformation into appropriate expression host (E. coli being most common)

• Induction of protein expression under optimized conditions

• Cell lysis under conditions suitable for membrane protein extraction

• Affinity chromatography using nickel or cobalt resins for His-tagged proteins

• Additional purification steps as needed (ion exchange, size exclusion)

• Quality control by SDS-PAGE analysis

Quality control metrics:

• Greater than 90% purity as determined by SDS-PAGE is achievable

• For membrane proteins like virB3, maintaining native conformation often requires detergent optimization

• Functional assays should be developed to ensure biological activity is preserved

Storage recommendations:

• Lyophilized powder form for long-term stability

• Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

• Addition of 5-50% glycerol (final concentration) for aliquots stored at -20°C/-80°C

• Avoiding repeated freeze-thaw cycles is critical for maintaining protein integrity

How can researchers effectively evaluate virB3 contribution to pathogenesis in laboratory models?

Several validated experimental approaches allow researchers to assess virB3's role in pathogenesis:

In vitro cellular models:

• Macrophage infection models (THP-1, RAW264.7, primary cells)

• Dendritic cell infection assays to evaluate immune modulation

• HeLa cells for non-professional phagocyte studies

• Intracellular bacterial enumeration through colony counting at different time points

Analysis parameters for cellular models:

• Invasion efficiency (percentage of cells infected)

• Intracellular replication kinetics

• Phagosome maturation markers

• Colocalization with host cell compartments

• Cell maturation markers for immune cells (CD40, CD83, CD86, HLA-ABC, HLA-D, CCR7)

• Cytokine production (particularly TNF-α, which is critical for DC maturation)

Mouse infection models:

• Intraperitoneal inoculation followed by bacterial enumeration in spleen and liver

• Comparison of virB3 mutants with wild-type strains for virulence assessment

• Measurement of bacterial persistence in tissues over time

• Immune response evaluation through serology and cellular immunity assays

Specialized techniques:

• Fluorescence microscopy to track intracellular bacteria with fluorescent reporters

• Flow cytometry for quantitative analysis of host cell responses

• RT-PCR for gene expression analysis during infection

• Signature-tagged mutagenesis for high-throughput screening of virulence factors

What are the challenges and solutions for expressing membrane-associated virB3 protein?

Major challenges:

• Low expression levels:

  • Membrane proteins often express poorly in heterologous systems

  • Toxicity to expression hosts can limit yield

• Protein misfolding:

  • Improper insertion into membranes leads to aggregation

  • Inclusion body formation may complicate purification

• Detergent compatibility:

  • Finding detergents that solubilize but maintain native structure

  • Different detergents may be needed for extraction versus storage

Effective solutions:

• Expression system optimization:

  • E. coli strains specialized for membrane proteins (C41, C43)

  • Lower induction temperatures (16-25°C instead of 37°C)

  • Controlled induction using tightly regulated promoters

  • Cell-free expression systems to avoid toxicity issues

• Fusion partners:

  • N-terminal His-tags have been successful for virB3

  • MBP, GST, or SUMO tags may improve solubility

  • Signal sequences for proper membrane targeting

• Detergent screening:

  • Systematic testing of detergent panels for extraction and purification

  • Detergent exchange during purification to improve stability

  • Lipid reconstitution for functional studies

• Alternative approaches:

  • Heterologous expression in related bacteria like Agrobacterium tumefaciens

  • Focus on smaller soluble domains for structural studies

  • Co-expression with partner proteins that may stabilize the complex

How can researchers effectively design experiments to investigate virB3 interactions with other T4SS components?

Recommended experimental approaches:

• Co-immunoprecipitation studies:

  • Generate antibodies against virB3 and other T4SS components

  • Pull-down experiments to identify protein-protein interactions

  • Western blot analysis of precipitated complexes

• Cross-linking strategies:

  • Chemical cross-linking of assembled T4SS complexes in membranes

  • Mass spectrometry analysis of cross-linked peptides

  • Identification of protein-protein interaction interfaces

• Bacterial two-hybrid systems:

  • Modified for membrane protein interactions

  • Screening for binary interactions between virB3 and other components

  • Validation of interactions through deletion mapping

• Heterologous expression systems:

  • Expression of the complete virB operon in Agrobacterium tumefaciens

  • Immunofluorescence analysis to confirm complex formation

  • Membrane fractionation to isolate assembled complexes

• Mutational analysis:

  • Targeted mutations in virB3 to disrupt specific interactions

  • Complementation assays to confirm functional importance

  • Analysis of effects on T4SS assembly and function

Data analysis considerations:

• Controls for non-specific interactions are critical

• Validation of interactions through multiple methodologies

• Comparison with known T4SS structures from related systems

• Integration of structural predictions with experimental data

How can virB3 studies contribute to new antimicrobial development strategies?

The essential role of virB3 in Brucella pathogenesis makes it an attractive target for antimicrobial development:

Target validation approaches:

• Confirmation of virB3 essentiality through conditional mutants

• Identification of virB3 domains critical for T4SS assembly

• Structural characterization to identify druggable sites

Screening strategies:

• Development of assays that measure T4SS function

• High-throughput screens for compounds that inhibit complex assembly

• Structure-based virtual screening against virB3 or its interaction interfaces

Potential therapeutic approaches:

• Small molecule inhibitors targeting virB3 protein-protein interactions

• Peptide inhibitors designed to disrupt T4SS assembly

• Compounds that prevent proper localization of virB3 to the membrane

• Agents that interfere with virB operon expression or regulation

Advantages of virB3/T4SS as targets:

• The T4SS has no homologs in mammalian cells, reducing off-target effects

• Targeting virulence rather than growth may reduce selection for resistance

• Conserved across Brucella species, potentially offering broad-spectrum activity

• Essential for intracellular survival, addressing a critical niche of infection

What are the implications of virB3 function for understanding bacterial evolution and adaptation?

Studies of virB3 and the T4SS provide insights into bacterial evolution:

Evolutionary conservation:

• The virB system is highly conserved across Brucella species

• Similar systems exist in phylogenetically related bacteria like Agrobacterium tumefaciens

• This conservation suggests ancient acquisition and important functional roles

Comparative genomics insights:

• The T4SS appears to have been adapted for different functions across bacterial species

• In Agrobacterium, it mediates DNA transfer to plant cells

• In Brucella, it facilitates intracellular survival in mammalian hosts

• This functional divergence represents adaptation to different ecological niches

Host-pathogen co-evolution:

• The virB system's role in immune modulation (preventing dendritic cell maturation)

• Adaptation to specific intracellular environments (phagosome acidification as a trigger)

• Specialization for creating unique replicative compartments within host cells

Horizontal gene transfer considerations:

• The conserved operon structure suggests acquisition as a functional unit

• Location on chromosome 2 in Brucella may indicate historical genomic rearrangements

• Comparison with related systems helps trace evolutionary histories of pathogenic bacteria

How do variations in virB3 sequence and expression affect Brucella's host range and tissue tropism?

The relationship between virB3 characteristics and host specificity:

Species-specific variations:

• While the virB operon is conserved across Brucella species, subtle variations exist

• Different Brucella species exhibit distinct host preferences (B. abortus in cattle, B. suis in swine)

• Analysis of virB3 sequence variations between species may reveal host adaptation signatures

Expression regulation differences:

• The virB operon regulation varies between fast-growing and classical Brucella strains

• B. suis biovar 5 (isolated from wild rodents) shows different metabolic capabilities compared to cattle-adapted strains

• These differences may influence tissue tropism and host range

Experimental evidence:

• VirB system is essential for intracellular survival across different Brucella species

• Different Brucella species establish infection in various host cell types

• The timing and magnitude of virB expression may vary between species and cell types

Host factors influencing virB function:

• Phagosome acidification serves as an activation signal for virB expression

• Different host cells may provide varying intracellular environments

• Host cell type-specific responses to T4SS effectors may influence tissue tropism

What research protocols are most effective for studying virB3's role in modulating host immune responses?

Recommended experimental approaches:

• Dendritic cell maturation assays:

  • Isolation and culture of human or mouse dendritic cells

  • Infection with wild-type Brucella and virB3 mutants

  • Analysis of maturation markers by flow cytometry (CD40, CD83, CD86, HLA-ABC, HLA-D, CCR7)

  • Measurement of cytokine production, particularly TNF-α

• T cell stimulation assays:

  • Co-culture of infected DCs with naïve T lymphocytes

  • Assessment of T cell proliferation and activation

  • Analysis of T cell polarization (Th1, Th2, Th17)

  • Evaluation of memory T cell generation

• Cytokine profiling:

  • Multiplex cytokine analysis of culture supernatants

  • Intracellular cytokine staining for single-cell analysis

  • Transcriptional profiling of cytokine genes

  • Comparison between wild-type and mutant infections

• In vivo immune response evaluation:

  • Mouse infection models using wild-type and virB3 mutants

  • Analysis of cellular immunity in infected animals

  • Histopathological assessment of granuloma formation

  • Adoptive transfer experiments to track specific immune cell populations

• TNF-α neutralization experiments:

  • Addition of exogenous TNF-α to wild-type-infected cells

  • Use of anti-TNF-α antibodies with mutant-infected cells

  • Assessment of the impact on DC maturation and function

  • Molecular analysis of TNF-α signaling pathway activation

These protocols provide comprehensive approaches to dissect the mechanisms by which virB3 and the T4SS modulate host immune responses, a critical aspect of Brucella's ability to establish chronic infection.

What are the emerging research trends in virB3 and T4SS studies?

Current and emerging research areas include:

• Structural biology approaches:

  • Cryo-electron microscopy of assembled T4SS complexes

  • Structural determination of individual components including virB3

  • Integration of structural data into complete T4SS models

• Systems biology integration:

  • Network analysis of virB3 interactions with host and bacterial proteins

  • Transcriptomic and proteomic profiling during infection

  • Mathematical modeling of T4SS assembly and function

• Advanced imaging techniques:

  • Super-resolution microscopy of T4SS in bacterial membranes

  • Live-cell imaging of T4SS dynamics during infection

  • Correlative light and electron microscopy approaches

• Synthetic biology applications:

  • Engineering T4SS components for biotechnology applications

  • Development of T4SS-based protein delivery systems

  • Creation of attenuated vaccine strains with modified virB systems

• Host-pathogen interface studies:

  • Identification of host cell receptors interacting with T4SS

  • Characterization of host cell responses to T4SS components

  • Detailed mapping of T4SS effector functions