Recombinant Brucella suis biovar 1 UPF0283 membrane protein BR1033/BS1330_I1029 (BR1033, BS1330_I1029)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Brucella suis biovar 1 UPF0283 membrane protein BR1033/BS1330_I1029, also referred to as BR1033 or BS1330_I1029, is a protein expressed in Brucella suis biovar 1 . It is sometimes produced using recombinant DNA technology and tagged with histidine (His) to facilitate purification .

CategoryDescription
SpeciesBrucella suis biovar 1
SynonymsBR1033, BS1330_I1029, UPF0283 membrane protein BR1033/BS1330_I1029
Gene NameBR1033
UniProt IDQ8G0Q5
Molecular WeightApproximately 40 kDa (including the His tag)
Purity>90% as determined by SDS-PAGE
SourceE. coli
TagHis-tagged
Protein LengthFull Length (1-357 amino acids)
FormLyophilized powder
AA SequenceMSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEILDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVALAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKGRQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGYVIFESARLIRRLSQLYGGRPGTFGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASRLSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK

Function and Characteristics

BR1033/BS1330_I1029 is annotated as a UPF0283 membrane protein, indicating it is a protein of unknown function (UPF) with a transmembrane domain . Proteins in this category often have poorly characterized functions but are conserved across species, suggesting they may play essential roles.

Expression and Purification

Recombinant BR1033/BS1330_I1029 is typically produced in E. coli and fused to an N-terminal His tag . The His tag allows for purification using affinity chromatography, where the protein binds to a nickel-charged resin and is later eluted.

Purification Steps:

  1. E. coli cells expressing the His-tagged BR1033/BS1330_I1029 are lysed.

  2. The lysate is passed through a nickel affinity column.

  3. The column is washed to remove unbound proteins.

  4. BR1033/BS1330_I1029 is eluted using a buffer containing imidazole, which competes with the protein for binding to the nickel ions.

  5. The eluted protein is dialyzed or buffer-exchanged to remove imidazole and stabilize the protein.

Role in Brucella suis Virulence

Brucella species are facultative intracellular bacteria that cause brucellosis, a zoonotic disease . A key aspect of Brucella virulence is their ability to survive and multiply within host phagocytes . Mutagenesis studies have identified several factors required for virulence, including the type IV secretion system (T4SS) encoded by the virB operon .

While BR1033/BS1330_I1029 is annotated as a UPF0283 membrane protein, other Brucella virulence factors have been identified, such as BvfA (Brucella virulence factor A), a small periplasmic protein essential for the virulence of Brucella suis . A BvfA knockout mutant was highly attenuated in both in vitro macrophage infection assays and in vivo in the murine model of brucellosis .

Potential Applications

ApplicationDescription
ELISABR1033/BS1330_I1029 can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) for the detection of antibodies against Brucella suis .
Vaccine DevelopmentOuter membrane proteins like Omp31 have been evaluated as vaccine candidates against Brucella melitensis and B. ovis . BR1033/BS1330_I1029, being a membrane protein, could be explored for similar applications.
Protein Function StudiesRecombinant BR1033/BS1330_I1029 can be used in in vitro assays to elucidate its biochemical function and role in Brucella pathogenesis .
Structural BiologyThe purified protein can be used for structural studies to determine its three-dimensional structure, providing insights into its function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize developing your specified tag.
Synonyms
BR1033; BS1330_I1029; UPF0283 membrane protein BR1033/BS1330_I1029
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella suis biovar 1 (strain 1330)
Target Names
BR1033
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTFGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links

KEGG: bms:BR1033

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.