Recombinant Brucella suis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Vaccine Development

Recombinant plsY is investigated as a vaccine candidate due to its potential immunogenicity.

ApplicationDetailsSource
Antigen SourcePurified His-tagged protein (1–201 aa) expressed in E. coli
Strain CompatibilityAvailable for biovar 1 (strain 1330) and ATCC 23445/NCTC 10510 strains

Diagnostic ELISA Assays

plsY serves as a target antigen in serological tests:

ParameterDetailsSource
SensitivityDetects anti-Brucella antibodies in clinical samples
Storage Conditions-20°C in Tris-based buffer with 50% glycerol

Production and Quality Control

Recombinant plsY is produced via heterologous expression in E. coli, with rigorous purification protocols:

StepDetailsSource
Expression SystemBacterial fermentation with inducible promoters (e.g., T7)
PurificationNickel affinity chromatography (His-tag)
Purity AssuranceSDS-PAGE and Western blotting to confirm protein integrity

Challenges and Future Directions

While recombinant plsY shows promise, gaps remain:

  • Functional Studies: Direct evidence of plsY’s role in Brucella pathogenesis is lacking.

  • Cross-Reactivity: Potential immunological overlap with other Brucella spp. requires validation.

  • Scalability: Optimization for large-scale production in vaccine pipelines is needed.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
plsY; BSUIS_B0598; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
plsY
Target Protein Sequence
MAEPGFFNAMLIGALIFGYVLGSIPFGLILARLAGLGDVRAIGSGNIGATNVLRTGNKKL AAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWAGALVFAAAWIVTALLTRYSSLSALVASLVVPIALYSRGNQALAALFAIMTVIVFI KHRANISRLLNGTESKIGAKG
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), yielding lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella suis Glycerol-3-phosphate acyltransferase (plsY) and what is its function?

Brucella suis Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein involved in the biosynthetic pathway of bacterial membrane phospholipids. The enzyme specifically catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate, which represents a critical step in the formation of lysophosphatidic acid, a precursor for membrane phospholipid synthesis . PlsY functions in conjunction with another enzyme called PlsX, which converts acyl-acyl carrier protein to acylphosphate, creating the substrate for PlsY's catalytic activity . In the context of Brucella suis metabolism, plsY belongs to the phospholipid biosynthetic machinery that enables the bacterium to maintain its membrane integrity, which is crucial for its survival and pathogenicity. The gene encoding this protein in B. suis is designated as plsY with the ordered locus name BSUIS_B0598 within the bacterial genome .

What are the optimal storage conditions for recombinant B. suis plsY?

Recombinant Brucella suis Glycerol-3-phosphate acyltransferase requires specific storage conditions to maintain its structural integrity and functional activity. According to documentation from commercial suppliers, the purified recombinant protein should be stored at -20°C for routine storage, while extended storage periods require temperatures of -20°C or preferably -80°C to minimize degradation . The protein is typically maintained in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for the stability of this particular protein . Researchers should avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and enzymatic activity. For experiments lasting up to one week, working aliquots can be safely stored at 4°C, reducing the need for frequent thawing of the main stock . When preparing the recombinant protein for long-term storage, dividing the stock into smaller working aliquots is strongly recommended to minimize exposure to damaging temperature fluctuations.

How is recombinant B. suis plsY typically expressed and purified for research use?

Expression and purification of recombinant B. suis plsY typically employs a systematic approach beginning with PCR synthesis of the gene based on its ORF sequence, followed by cloning into an appropriate expression vector. Researchers commonly use entry vectors initially, followed by recombination into destination vectors such as pET-DEST42, which allows for fusion with affinity tags including 6-His and V5 epitope tags at the C-terminus of the protein . These fusion tags facilitate both detection and purification of the recombinant protein. The recombinant constructs are typically transformed into expression-optimized E. coli strains like BL21, and protein expression is induced using IPTG, with optimal expression generally occurring 4-5 hours post-induction . For purification, nickel-based affinity chromatography is the preferred method, utilizing the 6-His tag on the recombinant protein. Commercial products like HisGrab plates enable efficient capture of the tagged protein from cell lysates . Detection and verification of the purified protein typically involve Western blot analysis using anti-6-His or anti-V5 antibodies, depending on the tag system employed in the expression construct .

What analytical methods are used to confirm the identity and purity of recombinant B. suis plsY?

Multiple analytical techniques are employed to verify the identity and purity of recombinant Brucella suis Glycerol-3-phosphate acyltransferase. Western blot analysis represents a primary verification method, typically using monoclonal antibodies directed against the fusion tags (either anti-6-His or anti-V5 antibodies) to confirm successful expression and purification of the target protein . SDS-PAGE separation on acrylamide gels (typically 13%) allows researchers to assess the molecular weight of the recombinant protein, confirming it matches the expected size based on the amino acid sequence . For higher resolution analysis, mass spectrometry can be employed to verify the exact molecular mass and potentially identify post-translational modifications. Functional assays measuring the enzymatic activity of the purified protein provide crucial confirmation that the recombinant protein retains its catalytic capabilities. Additionally, immunoreactivity tests using antisera from immunized animals can establish whether the recombinant protein preserves relevant antigenic properties, which is particularly important when the protein is being developed for diagnostic or vaccine applications .

What is the amino acid sequence and structural characteristics of B. suis plsY?

The amino acid sequence of Brucella suis Glycerol-3-phosphate acyltransferase (plsY) consists of 201 amino acids as follows: MAEPGFFNAMLÍGALIFGYVLGSIPFGLILARLALGDVRAIGSGNIGATNVLRTGNKKLAAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLIGLAWAGALVFAAAWIVTALLTRYSSLSALVASLVVPIALYSRGNQALAALFAIMTVIVFIKHRANISRLLNGTESKIGAKG . The protein is primarily hydrophobic in nature, consistent with its function as an integral membrane protein. Structural analysis based on homologous proteins indicates that B. suis plsY contains multiple membrane-spanning segments that anchor the protein in the bacterial cell membrane. While the specific membrane topology of B. suis plsY hasn't been explicitly described in the provided search results, studies on similar proteins from other bacterial species like Streptococcus pneumoniae suggest that plsY typically has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The protein belongs to the acyltransferase family with the Enzyme Commission number EC 2.3.1.n3, reflecting its catalytic function in transferring acyl groups from acylphosphate to glycerol-3-phosphate .

How does B. suis plsY participate in bacterial pathogenesis and virulence?

Brucella suis plsY contributes significantly to bacterial pathogenesis through its essential role in membrane phospholipid biosynthesis, which directly impacts the integrity and functionality of the bacterial cell envelope. The enzyme catalyzes a critical step in phosphatidic acid formation, which serves as a foundation for membrane biogenesis, allowing the bacterium to maintain its structural integrity during infection and intracellular survival . Brucella species exhibit a remarkable intracellular lifestyle that enables them to evade host immune responses, with the bacterium residing and replicating within macrophages, dendritic cells, and placental trophoblasts . The integrity of the bacterial membrane, which depends on proper phospholipid composition facilitated by plsY activity, is crucial for withstanding the harsh microenvironment of host cell phagosomes and establishing the replicative niche within host cells. The pathogen's stealthy nature, which includes evasion of intracellular destruction, depends on the type IV secretion system and proper membrane architecture, both requiring functional phospholipid biosynthesis pathways . Additionally, membrane phospholipids synthesized through the plsY pathway likely contribute to the characteristic lipid rafts and outer membrane components that mediate Brucella's interactions with host cell receptors and signaling systems during infection.

What are the challenges in expressing and purifying active recombinant B. suis plsY?

Expressing and purifying active recombinant Brucella suis plsY presents several significant challenges inherent to membrane-associated proteins. As an integral membrane protein with multiple transmembrane segments, plsY exhibits hydrophobicity that complicates expression in conventional E. coli systems, often leading to protein misfolding, aggregation, and formation of inclusion bodies, which can dramatically reduce yields of functional protein . The native membrane environment is crucial for proper folding and activity of plsY, necessitating careful consideration of detergents or membrane mimetics during extraction and purification to maintain protein functionality. Expression constructs must be carefully designed to balance fusion tags that facilitate purification while minimizing interference with protein folding or catalytic activity, with C-terminal tagging strategies often preferred to avoid disrupting signal sequences or transmembrane regions . Purification procedures typically require optimization of detergent types and concentrations to solubilize the protein from membranes without denaturing it, with mild non-ionic detergents often providing better results for maintaining enzymatic activity. Furthermore, functional assessment presents another layer of complexity, as enzymatic assays for acyltransferase activity require appropriate substrates (acylphosphate and glycerol-3-phosphate) and detection methods to monitor product formation under conditions that maintain the protein in its active conformation .

How can experimental approaches be designed to study enzymatic activity of recombinant B. suis plsY?

Designing robust experimental approaches to study the enzymatic activity of recombinant Brucella suis plsY requires careful consideration of the protein's membrane-associated nature and specific catalytic requirements. Researchers should establish in vitro assay systems that incorporate appropriate substrates—specifically acylphosphate and glycerol-3-phosphate—while maintaining conditions that preserve the enzyme's native conformation and activity . A common approach employs radioisotope-labeled substrates (such as 14C-glycerol-3-phosphate) to track the formation of lysophosphatidic acid through scintillation counting or thin-layer chromatography, providing quantitative measurements of enzymatic activity. Alternatively, coupled enzyme assays that link plsY activity to a spectrophotometrically detectable reaction can enable continuous monitoring of catalytic rates without radioactive materials. For membrane proteins like plsY, the inclusion of appropriate detergents or phospholipid vesicles can create a membrane-mimetic environment that better preserves enzyme functionality compared to aqueous solutions alone. Kinetic studies should measure reaction rates across varying substrate concentrations to determine important parameters like Km and Vmax, which characterize the enzyme's affinity for its substrates and maximum catalytic rate. Additionally, site-directed mutagenesis of conserved residues can provide valuable insights into the catalytic mechanism and structure-function relationships of this important bacterial acyltransferase .

What potential applications exist for recombinant B. suis plsY in vaccine development?

Recombinant Brucella suis Glycerol-3-phosphate acyltransferase (plsY) holds significant potential for vaccine development against brucellosis, a disease with substantial global impact causing economic losses, human morbidity, and a recognized bioterrorism threat . As an essential enzyme in bacterial membrane phospholipid biosynthesis, plsY represents a conserved antigen that could elicit protective immune responses when properly formulated and delivered. Recombinant plsY protein can be utilized in subunit vaccine approaches, either alone or in combination with other Brucella immunogens, to stimulate specific antibody and T-cell responses without the risks associated with live attenuated vaccines . Research indicates that outer membrane proteins of Brucella species, including membrane-associated enzymes like plsY, can successfully induce immune reactions in animal models, as evidenced by studies showing high binding activity with immunized rabbit antiserum . A significant advantage of targeting plsY in vaccine development is its essential nature for bacterial survival, which limits the pathogen's ability to evade immunity through mutation or deletion of this target. Vaccine formulations incorporating recombinant plsY could be evaluated through challenge studies in animal models, measuring parameters such as bacterial burden, serological responses, and cytokine profiles, particularly IFN-γ production, which is known to be crucial for protective immunity against intracellular pathogens like Brucella .

How does B. suis plsY compare to related enzymes in other bacterial pathogens?

The Brucella suis Glycerol-3-phosphate acyltransferase (plsY) shares fundamental catalytic mechanisms with homologous enzymes in other bacterial pathogens while exhibiting species-specific adaptations that may influence its role in pathogenesis and potential as a therapeutic target. Across bacterial species, plsY functions in the acyltransferase pathway to produce lysophosphatidic acid, a critical precursor in membrane phospholipid biosynthesis, but the specific membrane topology and substrate preferences may vary between organisms . Studies on Streptococcus pneumoniae plsY have revealed a membrane topology with five membrane-spanning segments and specific orientation of amino terminus and loops on the external face of the membrane, which may serve as a comparative model for understanding B. suis plsY structure . Unlike mammalian GPAT enzymes that exist in four isoforms with distinct subcellular localizations and substrate preferences, bacterial plsY proteins typically function as single isoforms that participate in a two-step process involving PlsX converting acyl-acyl carrier protein to acylphosphate, followed by plsY transferring the acyl group to glycerol-3-phosphate . The bacterial plsY pathway represents an evolutionarily distinct mechanism from the mammalian direct acylation of glycerol-3-phosphate using acyl-CoA, highlighting a potential selective target for antimicrobial development with reduced risk of affecting host enzymes . Comparative genomic and structural analyses across pathogenic bacteria can reveal conserved regions essential for catalytic function versus variable regions that may contribute to species-specific membrane compositions and consequently pathogenic properties.

What expression systems optimize yield and activity of recombinant B. suis plsY?

Selecting appropriate expression systems for recombinant Brucella suis plsY requires balancing protein yield with preservation of enzymatic activity, particularly given the challenges associated with membrane protein expression. E. coli-based systems using BL21(DE3) strains coupled with pET vectors (such as pET-DEST42) have proven successful for initial expression studies, offering advantages including rapid growth, high protein yields, and compatibility with affinity tag purification strategies . For membrane proteins like plsY, utilizing E. coli strains specifically engineered for membrane protein expression, such as C41(DE3) or C43(DE3) derivatives of BL21, can significantly improve folding and reduce cytotoxicity associated with membrane protein overexpression. Expression conditions require careful optimization, with IPTG induction typically performed at lower temperatures (16-25°C rather than 37°C) and reduced inducer concentrations to slow protein production and facilitate proper folding, with reported optimal expression times around 4-5 hours post-induction . Alternative expression hosts such as Bacillus subtilis, which naturally produces large quantities of membrane proteins, or eukaryotic systems like Pichia pastoris might provide more suitable membrane environments for proper folding of functionally active plsY. Co-expression with molecular chaperones or fusion with solubility-enhancing partners like thioredoxin or SUMO can further improve proper folding, though care must be taken to ensure fusion partners don't interfere with enzymatic activity or native membrane insertion .

How can researchers optimize purification protocols for membrane-associated B. suis plsY?

Purification of membrane-associated Brucella suis plsY requires specialized protocols that maintain the protein in a native-like environment while achieving sufficient purity for downstream applications. The initial critical step involves efficient extraction from cellular membranes, typically employing a combination of mechanical disruption (sonication or French press) followed by careful solubilization using detergents that preserve protein structure and function . Detergent selection represents a crucial decision point, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often proving more effective for maintaining enzymatic activity than harsher ionic detergents like SDS, though the optimal detergent must be determined empirically for each specific membrane protein. Affinity chromatography utilizing the incorporated 6-His tag provides an efficient initial purification step, with nickel-based matrices (such as HisGrab plates) effectively capturing the tagged protein from detergent-solubilized lysates . Following initial capture, researchers should implement additional purification steps such as ion exchange or size exclusion chromatography to achieve higher purity, particularly important for structural studies or enzymatic characterizations. Throughout the purification process, maintaining appropriate detergent concentrations above their critical micelle concentration in all buffers is essential to prevent protein aggregation and precipitation. For functional studies, consideration should be given to reconstituting the purified protein into liposomes or nanodiscs, which provide a more native-like phospholipid bilayer environment that can significantly enhance enzymatic activity compared to detergent micelles .

What methods can be used to study B. suis plsY interactions with host cellular components?

Investigating interactions between Brucella suis plsY and host cellular components requires specialized methodologies that capture both direct protein-protein interactions and broader functional impacts on host cells. Co-immunoprecipitation (Co-IP) studies using antibodies against epitope-tagged recombinant plsY can identify host proteins that physically interact with the bacterial enzyme during infection, though care must be taken to use detergent conditions that preserve membrane protein interactions . Yeast two-hybrid systems, particularly those adapted for membrane proteins like the split-ubiquitin system, offer alternative approaches for screening potential interacting partners, while bimolecular fluorescence complementation (BiFC) provides visual confirmation of interactions in cellular contexts. Bacterial infection models using cultured macrophages or dendritic cells, which represent natural host cells for Brucella, can be employed to study the broader impact of wild-type versus plsY-mutant strains on host cell processes, including endosomal trafficking, cytokine production, and cell survival . Newer technologies like proximity labeling methods (BioID or APEX) can identify proteins in close proximity to plsY within living cells, offering insights into the microenvironment of the bacterium during different stages of infection. For studying the impact of plsY-dependent bacterial lipids on host cell membranes and signaling, comparative lipidomics approaches can characterize alterations in host membrane composition during infection with wild-type versus plsY-deficient Brucella strains .

How can CRISPR-Cas9 technology be applied to study B. suis plsY function?

CRISPR-Cas9 technology provides powerful approaches for investigating Brucella suis plsY function through precise genetic manipulation, enabling researchers to address fundamental questions about its role in bacterial physiology and pathogenesis. Since plsY likely functions in essential phospholipid biosynthesis pathways, conditional knockout systems are particularly valuable, allowing researchers to control gene expression through inducible promoters that permit growth under permissive conditions followed by gene silencing to observe phenotypic consequences. CRISPR interference (CRISPRi) offers advantages over complete gene deletion for studying essential genes like plsY, enabling tunable repression of gene expression rather than complete elimination, thus allowing researchers to examine the effects of reduced but not abolished enzyme activity on bacterial growth, membrane integrity, and virulence. For structural-functional studies, CRISPR-Cas9 can facilitate precise point mutations in conserved catalytic residues or membrane-spanning domains, allowing researchers to correlate specific amino acid changes with alterations in enzymatic activity, membrane localization, or pathogenic properties. Knock-in approaches can introduce reporter fusions (such as fluorescent proteins) at the endogenous plsY locus, enabling real-time visualization of protein localization and expression levels during different growth phases or infection stages. Additionally, CRISPR-based gene editing in host cells can be employed to knockout potential interaction partners or downstream effectors, creating cellular models to study how specific host factors influence Brucella plsY activity or its contributions to intracellular survival .

How can researchers distinguish between direct effects of plsY and indirect metabolic consequences?

Distinguishing between direct effects of Brucella suis plsY activity and indirect metabolic consequences represents a significant challenge requiring multiple complementary experimental approaches. Researchers should establish clear temporal relationships between plsY activity modulation and observed phenotypic changes, using inducible expression systems or rapid inhibition approaches to determine how quickly alterations appear after enzyme activity changes, with immediate effects more likely representing direct consequences. Comprehensive metabolomic profiling can identify specific lipid species directly produced by plsY catalytic activity versus secondary metabolic adaptations, with particular attention to lysophosphatidic acid levels as the immediate product of the enzymatic reaction . Genetic complementation studies provide powerful evidence for causality, where phenotypes observed in plsY mutants should be rescued by expressing wild-type plsY but not catalytically inactive variants carrying mutations in key active site residues. In vitro reconstitution experiments using purified components represent the gold standard for establishing direct enzymatic activities, where recombinant plsY should catalyze the conversion of acylphosphate and glycerol-3-phosphate to lysophosphatidic acid in a defined system without additional cellular factors . Computational modeling approaches using systems biology frameworks can predict network-wide consequences of plsY perturbation, helping researchers distinguish between immediate reaction products and downstream metabolic adaptations resulting from altered phospholipid homeostasis. Correlation versus causation should be carefully considered, with researchers explicitly testing causative relationships through intervention studies rather than relying solely on observational correlations between plsY activity and bacterial phenotypes .

What controls are essential for immunological studies involving recombinant B. suis plsY?

Immunological studies involving recombinant Brucella suis plsY require rigorous controls to ensure experimental validity and accurate interpretation of results. Researchers must include both positive and negative antigen controls in all immunological assays, with other recombinant B. suis proteins serving as specificity controls and well-characterized immunogens like LacZ recombinant protein providing technical validation of assay performance . Pre-immune sera controls are essential when evaluating antibody responses, establishing baseline reactivity before immunization to distinguish specific immune responses from pre-existing cross-reactive antibodies. Comparative analysis using both wild-type and heat-denatured recombinant plsY can differentiate between antibodies recognizing conformational epitopes versus linear sequences, providing insights into the nature of the immune response. When evaluating plsY as a potential vaccine component, researchers should include controls addressing adjuvant effects by comparing responses to adjuvant alone versus adjuvant plus recombinant protein. Testing for cross-reactivity with homologous proteins from other bacterial species helps assess the specificity of immune responses and potential cross-protection. For T-cell response studies, controls addressing potential endotoxin contamination are critical, as even trace amounts of bacterial lipopolysaccharide can stimulate non-specific immune activation, confounding interpretation of antigen-specific responses. Additionally, researchers should employ appropriate isotype control antibodies in immunological detection methods to establish thresholds for positive reactivity and control for non-specific binding, particularly important when working with membrane proteins that may exhibit hydrophobic interactions with antibodies .

How might structural biology techniques advance understanding of B. suis plsY?

Advanced structural biology techniques offer tremendous potential to elucidate the molecular architecture and functional mechanisms of Brucella suis plsY, providing insights that could inform antimicrobial development and vaccine design. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and could determine the three-dimensional structure of plsY in various conformational states, capturing the enzyme during different stages of its catalytic cycle in a near-native lipid environment. X-ray crystallography, while challenging for membrane proteins, could provide high-resolution structural data if suitable crystals can be obtained, potentially through innovative approaches like lipidic cubic phase crystallization or the use of antibody fragments to stabilize specific conformations. Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, can provide valuable information about protein dynamics and substrate interactions within membrane environments, complementing static structural data from other techniques. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers insights into protein flexibility and solvent accessibility, identifying regions that undergo conformational changes upon substrate binding or during catalysis. Molecular dynamics simulations using structural data can model plsY within a phospholipid bilayer, predicting how the enzyme interacts with its membrane environment and identifying potential druggable sites. Integrating these complementary structural approaches would create a comprehensive understanding of plsY structure-function relationships, potentially revealing unique features that distinguish bacterial acyltransferases from mammalian counterparts, thereby facilitating the design of selective inhibitors as novel antibacterial agents against this significant zoonotic pathogen .

What emerging technologies might enhance B. suis plsY research?

Emerging technologies across multiple scientific disciplines offer exciting opportunities to advance Brucella suis plsY research, potentially overcoming current technical limitations and opening new investigative avenues. Single-molecule enzymology techniques, including fluorescence resonance energy transfer (FRET) and total internal reflection fluorescence (TIRF) microscopy, could track individual plsY molecules during catalysis, revealing transient conformational states and mechanistic details obscured in bulk measurements. Nanodiscs and polymer-based membrane mimetics represent cutting-edge approaches for studying membrane proteins like plsY, providing stable, defined lipid environments that better maintain native protein conformations than traditional detergent systems while remaining compatible with a wide range of biophysical techniques. CRISPR-based transcriptional modulation systems, including both activation (CRISPRa) and interference (CRISPRi) approaches, enable precise, tunable control over plsY expression levels in living bacteria, facilitating studies of dose-dependent effects on bacterial physiology and pathogenesis. Advanced mass spectrometry techniques, particularly native mass spectrometry and crosslinking mass spectrometry (XL-MS), can characterize protein-protein interactions involving plsY within the bacterial membrane, identifying potential regulatory partners or multiprotein complexes. Microfluidic organ-on-a-chip technologies could create sophisticated infection models incorporating relevant host cell types in physiologically relevant arrangements, enabling detailed investigation of how plsY contributes to Brucella's interactions with host tissues under controlled conditions that better recapitulate in vivo complexity. Artificial intelligence approaches, particularly deep learning algorithms, could analyze complex datasets spanning genomics, proteomics, and metabolomics to identify non-obvious relationships between plsY function and bacterial phenotypes, generating novel hypotheses for experimental testing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.