Recombinant Brucella suis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant B. suis mscL is a full-length protein (1–138 amino acids) expressed in E. coli with an N-terminal His tag for purification . It is classified as a large-conductance mechanosensitive channel (MSC) and shares structural and functional homology with mscL channels in other bacteria, such as Mycobacterium tuberculosis and E. coli .

PropertyValue/Description
Gene NamemscL
UniProt IDB0CJU8 (for B. suis)
Protein Length138 amino acids (full-length)
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Production and Purification

Recombinant B. suis mscL is produced via heterologous expression in E. coli, followed by purification using affinity chromatography (His tag) and thrombin cleavage . Critical steps include:

  1. Expression: Plasmid-based overexpression in E. coli strains lacking endogenous mscL to avoid interference .

  2. Purification:

    • Step 1: Cell lysis and solubilization in detergent.

    • Step 2: Nickel affinity chromatography for His-tagged protein capture.

    • Step 3: Thrombin cleavage to remove the His tag .

  3. Reconstitution: Purified protein is reconstituted into liposomes for functional studies (e.g., patch-clamp analysis) .

Functional Validation

Reconstituted B. suis mscL exhibits hallmark mechanosensitive properties:

PropertyObservation
Conductance~3 nS in symmetric 200 mM KCl
Pressure SensitivityOpens under ~20 mN/m membrane tension
InhibitionBlocked by gadolinium (Gd³⁺)
Ion SelectivityNon-selective (permits K⁺, Na⁺, Cl⁻, etc.)

Functional reconstitution into artificial membranes confirms its ability to regulate ion flux under mechanical stress, mimicking native bacterial responses .

Mechanosensitive Channel Studies

  • Gating Mechanism: Mutagenesis and cryo-EM studies of homologs (e.g., M. tuberculosis mscL) provide insights into TM1 tilt and pore expansion .

  • Inhibitor Development: Screening for small molecules targeting mscL’s conserved regions (e.g., TM1) as antimicrobial agents .

Biotechnological Tools

  • Pressure Sensors: Engineered mscL variants are used in biosensors to detect mechanical forces in cellular environments .

  • Vaccine Development: While not directly a vaccine target, mscL’s structural insights inform broader studies of Brucella pathogenesis .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; storage at -20°C/-80°C is recommended .

  • Expression Limitations: B. suis mscL’s hydrophobicity complicates solubility, necessitating optimized detergents and refolding protocols .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; BSUIS_A0347; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function

This protein is a large-conductance mechanosensitive channel (mscL) that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant B. suis MscL protein?

For optimal stability and activity of recombinant B. suis MscL protein:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For extended storage, maintain in buffer containing 50% glycerol at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, which can degrade protein function

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What expression systems are most effective for producing recombinant B. suis MscL?

The most effective expression system for recombinant B. suis MscL is E. coli-based expression. Specifically:

  • Bacterial Expression System: E. coli is the preferred host for B. suis MscL expression, with BL21(DE3) strains commonly used for high protein yields .

  • Expression Vectors: Several vector systems have proven successful:

    • pET expression systems with T7 promoters for high-level expression

    • Fusion tag vectors (His-tag, GST-tag) to facilitate purification

    • The pBBR1-MCS shuttle vector has been used successfully for Brucella protein expression

  • Induction Conditions:

    • IPTG induction (typically 0.5-1 mM) for T7-based systems

    • Induction at lower temperatures (16-25°C) may improve proper folding

    • Extended expression times (overnight) at lower temperatures can increase yields of properly folded membrane proteins

What are the most effective methods for purifying recombinant B. suis MscL?

The following purification strategy is recommended based on research protocols:

Step 1: Membrane Protein Extraction

  • Lyse cells using sonication or French press in buffer containing 20-50 mM Tris-HCl (pH 8.0), 100-300 mM NaCl

  • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilize membrane proteins using detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG)

Step 2: Affinity Chromatography

  • For His-tagged MscL:

    • Utilize Ni-NTA affinity chromatography

    • Wash with 20-40 mM imidazole to reduce non-specific binding

    • Elute with 250-500 mM imidazole

  • For GST-tagged MscL:

    • Use glutathione-coated beads for purification

    • Cleave with thrombin if tag-free protein is desired

Step 3: Size Exclusion Chromatography

  • Further purify protein using gel filtration to separate oligomeric states and remove aggregates

  • Typical buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM

Purity assessment by SDS-PAGE typically shows >90% purity for properly purified preparations .

How can researchers troubleshoot low expression yields of recombinant B. suis MscL?

When experiencing low expression yields, consider these common issues and solutions:

ProblemPossible CauseSolution
Low protein expressionProtein toxicity to E. coliUse tightly regulated promoters; lower temperature during induction
Codon biasUse codon-optimized gene or E. coli strains with rare codon tRNAs
Unstable mRNACheck for rare codons or secondary structures in mRNA
Protein in inclusion bodiesOverexpressionReduce IPTG concentration; induce at lower OD600
Improper foldingExpress at lower temperatures (16-20°C); add osmolytes or chaperones
Poor solubilizationInsufficient detergentOptimize detergent type and concentration; test different detergents (DDM, OG, LDAO)
Detergent incompatibilityScreen multiple detergents for extraction efficiency
Low purityNon-specific bindingIncrease imidazole in wash buffers; add low concentration of detergent in wash buffers

Additionally, fusion with MBP (maltose-binding protein) has been shown to improve solubility of membrane proteins and could be considered if standard approaches fail .

What methods are used to assess the functionality of purified recombinant B. suis MscL?

The functionality of purified recombinant B. suis MscL can be assessed using several complementary approaches:

  • Patch-Clamp Electrophysiology:

    • Reconstitute purified MscL into artificial liposomes

    • Form giant unilamellar vesicles (GUVs) for patch-clamp analysis

    • Apply negative pressure to patches to measure pressure-dependent channel opening

    • Analyze conductance values (typically several nanosiemens for MscL channels)

    • Test sensitivity to gadolinium (Gd³⁺), a known mechanosensitive channel blocker

  • Fluorescence-Based Assays:

    • Reconstitute MscL into liposomes containing self-quenching fluorescent dyes

    • Monitor dye release upon osmotic downshock as a measure of channel activity

    • Quantify fluorescence changes to determine relative activity of wild-type versus mutant channels

  • In Vivo Complementation Assays:

    • Express B. suis MscL in MscL-deficient E. coli strains

    • Subject cells to hypoosmotic shock

    • Measure survival rates as indicator of functional complementation

What is the recommended protocol for reconstituting B. suis MscL into liposomes for functional studies?

Based on successful protocols for mechanosensitive channel reconstitution:

Materials Required:

  • Purified B. suis MscL protein (>90% purity)

  • Lipids (typically 3:1 mixture of POPE:POPG)

  • Detergent (DDM or Triton X-100)

  • Bio-Beads SM-2 for detergent removal

Reconstitution Protocol:

  • Prepare lipid mixture in chloroform and dry under nitrogen gas

  • Hydrate lipid film to 5 mg/ml in reconstitution buffer (20 mM HEPES pH 7.2, 150 mM KCl)

  • Sonicate to form small unilamellar vesicles

  • Solubilize vesicles with detergent (final ratio lipid:detergent = 1:3 w/w)

  • Add purified MscL (protein:lipid ratio = 1:200 to 1:50 w/w)

  • Remove detergent using Bio-Beads SM-2 (three additions over 24 hours at 4°C)

  • Collect proteoliposomes by ultracentrifugation (100,000 × g for 1 hour)

  • Resuspend in desired buffer for functional assays

Successful reconstitution can be verified by freeze-fracture electron microscopy or negative staining EM to visualize protein incorporation into liposomes.

How can researchers distinguish between functional and non-functional forms of reconstituted B. suis MscL?

To distinguish between functional and non-functional forms:

  • Electrophysiological Analysis:

    • Functional MscL channels show characteristic conductance (~3 nS in 200 mM KCl)

    • Functional channels exhibit pressure-dependent gating with defined threshold

    • Multiple subconductance states may be observed during opening/closing

    • Channel activity should be inhibited by specific blockers like gadolinium

  • Biochemical Verification:

    • Properly folded MscL shows resistance to limited proteolysis compared to misfolded protein

    • Circular dichroism spectroscopy can confirm proper secondary structure content

    • Size-exclusion chromatography profiles can distinguish between proper oligomeric assembly and aggregates

  • Antibody Blocking Tests:

    • Anti-MscL antibodies should block channel activity when preincubated with functional protein

    • This test can confirm that observed channel activity is specifically due to MscL

How can recombinant B. suis MscL be used in diagnostic assays for brucellosis?

Recombinant B. suis MscL has potential applications in diagnostic assays for brucellosis:

  • ELISA-Based Detection:

    • Purified recombinant MscL can be used as coating antigen in indirect ELISA

    • Patient or animal sera can be tested for specific anti-MscL antibodies

    • Can be combined with other Brucella antigens to improve sensitivity

    • Potential advantages include defined composition and batch consistency compared to whole-cell extracts

  • Multiplex Serological Assays:

    • MscL can be incorporated into panels with other Brucella antigens (like OMP25, OMP28, OMP31)

    • Combined antigen approaches have shown improved sensitivity (up to 100%) and specificity in experimental models

    • Can help differentiate between true infections and false positive serological reactions caused by cross-reactive antibodies

  • Considerations for Assay Development:

    • Validation required with panels of known positive and negative sera

    • Cross-reactivity testing needed against antibodies to related bacterial species

    • Optimization of cutoff values for different host species and epidemiological settings

What role might B. suis MscL play in Brucella pathogenesis and survival in host environments?

The role of MscL in Brucella pathogenesis involves several potential mechanisms:

  • Adaptation to Osmotic Stress:

    • Brucella encounters varying osmotic environments during infection

    • MscL likely helps bacteria survive osmotic transitions when moving between bloodstream and intracellular niches

    • May be particularly important during initial phases of infection when bacteria transition between environments

  • Acid Stress Response:

    • Brucella must survive acidic conditions in phagolysosomes

    • Mechanosensitive channels may contribute to proton extrusion or cytoplasmic pH homeostasis

    • Research on B. suis and B. microti shows specific gene expression patterns in response to acid stress that may involve membrane channels

  • Intracellular Survival:

    • Brucella modifies its membrane proteins to adapt to intracellular environments

    • MscL could play a role in maintaining membrane integrity during phagosome-to-replicative niche transition

    • May contribute to the bacteria's ability to avoid host immune detection

Further research using MscL knockout strains would be valuable to definitively establish its role in virulence and intracellular survival.

How does B. suis MscL compare to homologous proteins in other Brucella species, and what are the implications for cross-protection in vaccine development?

Comparative analysis of MscL across Brucella species:

SpeciesSequence Identity to B. suis MscLKey DifferencesImmunological Implications
B. abortus>95% (estimated)Minor amino acid substitutions in cytoplasmic domainsHigh likelihood of cross-reactivity
B. melitensis>90% (estimated)Possible variations in surface-exposed loopsPotential for species-specific epitopes
B. canisNot fully characterizedLimited data availableUnknown cross-protection
B. microtiNot fully characterizedMay contain adaptive mutations related to environmental persistenceCould provide broader protection

Implications for vaccine development:

  • The high conservation of MscL across Brucella species suggests it could potentially elicit cross-protective immunity.

  • Studies with recombinant Brucella outer membrane proteins (OMPs) have demonstrated cross-protection between some Brucella species, suggesting a similar approach might work with MscL-based vaccines .

  • Vaccination studies with attenuated B. suis strain 1330ΔctpA showed 4-5 log₁₀ protection against both B. abortus and B. suis challenge, but not against B. melitensis, indicating species-specific factors influence cross-protection .

What mutagenesis approaches can be used to study structure-function relationships in B. suis MscL?

Several mutagenesis approaches can be employed:

  • Site-Directed Mutagenesis:

    • Target conserved residues in transmembrane domains that may form the channel pore

    • Modify hydrophobic residues at the protein-lipid interface to alter tension sensitivity

    • Mutate charged residues in cytoplasmic domains to study their role in channel gating

    • Create cysteine mutants for accessibility studies using thiol-specific reagents

  • Domain Swapping:

    • Exchange domains between B. suis MscL and E. coli MscL to identify species-specific functional elements

    • Create chimeric proteins with other mechanosensitive channels to study gating mechanisms

  • Insertion of Reporter Groups:

    • Introduce fluorescent probes at specific sites to monitor conformational changes

    • Create disulfide cross-linking mutants to trap the channel in specific conformational states

  • Experimental Validation:

    • Express mutant proteins in E. coli MscL knockout strains

    • Evaluate channel function using patch-clamp electrophysiology

    • Assess pressure sensitivity, conductance, and ion selectivity changes

    • Correlate functional changes with structural insights from molecular modeling

How can researchers use B. suis MscL as a model system for studying bacterial membrane protein biogenesis?

B. suis MscL offers several advantages as a model system:

  • Membrane Targeting and Insertion Studies:

    • Monitor effects of signal sequence modifications on membrane localization

    • Study requirements for proper insertion into bacterial membranes

    • Investigate the role of translocon machinery in MscL biogenesis using in vitro translation systems

  • Folding and Assembly Pathways:

    • Track oligomeric assembly using crosslinking approaches

    • Identify chaperones involved in membrane protein folding

    • Study effects of lipid composition on proper folding and assembly

  • Post-Translational Modifications:

    • Investigate potential modifications that might regulate channel function

    • Study degradation pathways for misfolded membrane proteins

  • Membrane Microdomain Association:

    • Determine if MscL preferentially associates with specific lipid domains

    • Study impact of membrane fluidity on channel distribution and function

  • Experimental Approaches:

    • Pulse-chase experiments to monitor biogenesis kinetics

    • Blue native PAGE to analyze assembly intermediates

    • Protease accessibility assays to determine topology

    • FRET-based approaches to study conformational changes during assembly

What are the most significant challenges in structural studies of B. suis MscL, and how might they be overcome?

Major Challenges:

  • Membrane Protein Crystallization:

    • Inherent flexibility of membrane proteins impedes crystal formation

    • Detergent micelles create heterogeneous environments

    • Protein-detergent complexes have large solvent content, leading to weak crystal contacts

  • Conformational Heterogeneity:

    • MscL exists in multiple conformational states (closed, intermediate, open)

    • Capturing specific states for structural analysis is difficult

  • Preserving Native Structure:

    • Detergent extraction may alter native conformation

    • Lipid-protein interactions important for function may be lost

Innovative Solutions:

  • Advanced Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization to maintain lipidic environment

    • Crystallization in nanodiscs or amphipols to preserve native-like environment

    • Use of antibody fragments or designed binding proteins to stabilize specific conformations

  • Cryo-Electron Microscopy:

    • Single-particle cryo-EM to visualize channel in detergent micelles or nanodiscs

    • Can potentially capture multiple conformational states in a single sample

    • Recent advances in direct electron detectors allow near-atomic resolution

  • Integrative Structural Biology:

    • Combine lower-resolution cryo-EM with molecular dynamics simulations

    • Use distance constraints from crosslinking or spectroscopy to guide modeling

    • Employ hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Novel Expression Systems:

    • Cell-free expression systems to directly incorporate protein into nanodiscs

    • Expression in lipid-producing strains to facilitate co-purification with native lipids

How might recombinant B. suis MscL contribute to the development of novel antimicrobial strategies?

Recombinant B. suis MscL offers several promising avenues for antimicrobial development:

  • MscL as a Drug Target:

    • Design compounds that inappropriately activate MscL, causing bacterial cell lysis

    • Develop molecules that block MscL closure, disrupting osmoregulation

    • Target Brucella-specific features of MscL that differ from host cell mechanosensitive channels

  • Drug Delivery Applications:

    • Engineer MscL variants with modified gating properties responsive to specific stimuli

    • Develop MscL-based delivery systems to introduce antibiotics into bacterial cells

    • Create "triggered" liposomes containing antimicrobials that release their cargo upon MscL activation

  • Vaccine Development:

    • Incorporate MscL into subunit vaccine formulations, potentially with other membrane proteins

    • Engineer attenuated Brucella strains with modified MscL expression

    • Develop cross-protective immunity targeting conserved epitopes across Brucella species

  • Biosensor Applications:

    • Create biosensors based on MscL gating to detect membrane-active antimicrobials

    • Develop screening systems for compounds that interact with bacterial membranes

Current research suggests that membrane proteins like MscL are promising targets for next-generation antimicrobials that could help address the growing problem of antibiotic resistance .

What are the current limitations in our understanding of B. suis MscL function, and what research approaches might address these gaps?

Knowledge Gaps:

  • Structural Determinants of Gating:

    • Precise mechanism of tension sensing remains unclear

    • Conformational changes during channel opening not fully characterized

    • Role of specific amino acids in channel selectivity undetermined

  • Regulatory Mechanisms:

    • Whether MscL activity is modulated by other cellular components

    • Potential roles in signaling beyond osmotic protection

    • Regulation of expression under different environmental conditions

  • Host-Pathogen Interactions:

    • Whether host immune responses target MscL during infection

    • Potential immunomodulatory effects of MscL

    • Role in bacterial adaptation to intracellular environments

Research Approaches:

  • High-Resolution Structural Studies:

    • Cryo-EM of MscL in different conformational states

    • Time-resolved structural methods to capture channel dynamics

    • Molecular dynamics simulations to model gating transitions

  • Systems Biology Approaches:

    • Transcriptomic analysis of MscL expression under various stresses

    • Interactome studies to identify protein-protein interactions

    • In vivo studies using reporter fusions to monitor expression patterns

  • Advanced Functional Characterization:

    • Single-molecule force spectroscopy to measure tension sensitivity

    • In vivo measurements of channel activity during infection

    • Development of specific inhibitors as research tools

  • Comparative Studies:

    • Detailed comparison of MscL across Brucella species and biovars

    • Analysis of MscL evolution in field isolates versus laboratory strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.