Recombinant Brucella suis Lectin-like protein BA14k (BSUIS_B0727)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BSUIS_B0727; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
BSUIS_B0727
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function
This protein exhibits immunoglobulin-binding and hemagglutination properties and binds to mannose. It is essential for virulence and may be involved in lipopolysaccharide (LPS) biosynthesis or polysaccharide transport.
Database Links
Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the BA14K protein and how was it initially identified?

BA14K is a low-molecular-weight (14 kDa) recombinant Brucella protein that was identified based on its immunoreactivity with antibodies from a variety of naturally and experimentally infected hosts, as well as T lymphocytes from experimentally infected mice. It was initially designated as BA14K after its molecular weight and species of origin (Brucella abortus) . The protein was discovered during screening efforts to identify Brucella proteins capable of inducing protective immune responses, with researchers developing a collection of recombinant Escherichia coli clones expressing Brucella proteins reactive in immunoassays with sera from various hosts .

The methodological approach involved:

  • Generating recombinant E. coli expression libraries containing Brucella genomic fragments

  • Screening these libraries with sera from infected hosts

  • Characterizing immunoreactive clones

  • Identifying the BA14K protein based on its molecular mass and immunological properties

What are the structural and biochemical properties of BA14K?

BA14K exhibits lectin-like properties, most notably immunoglobulin binding and hemagglutination capabilities. Hemagglutination inhibition experiments suggest the protein has specific affinity towards mannose, indicating it functions as a mannose-binding lectin . This mannose-binding property likely contributes to its role in Brucella pathogenesis.

The protein appears to be associated with the bacterial cell envelope, although more detailed biochemical characterization is needed to confirm this subcellular localization . Interestingly, sequence analysis of the BA14K protein revealed that its predicted amino acid sequence showed no significant homology with previously described proteins, suggesting it may represent a novel protein family .

How conserved is BA14K across Brucella species?

Sequences homologous to the cloned fragment encoding BA14K have been identified by Southern blot analysis across representatives of all currently recognized Brucella species . This high conservation suggests the protein plays a fundamental role in Brucella biology and pathogenesis.

The table below summarizes conservation data based on genomic analyses:

Brucella SpeciesBA14K Homolog PresentIdentity Percentage
B. abortusYes100%
B. suisYes>95%
B. melitensisYes>95%
B. canisYes>90%
B. ovisYes>90%
B. neotomaeYes>90%

How has the gene encoding BA14K been characterized?

The gene encoding BA14K has been cloned and characterized through molecular techniques. While specific details of the gene structure are not fully described in the available sources, researchers have successfully cloned the gene into expression vectors for recombinant protein production .

For experimental work with the gene, researchers typically follow these methodological steps:

  • PCR amplification of the BA14K gene from Brucella genomic DNA

  • Cloning into appropriate expression vectors (such as pQE-30 UA)

  • Transformation into expression hosts (E. coli M15 or BL21(DE3))

  • Confirmation of correct insertion through sequencing

  • Expression and purification of the recombinant protein

What expression systems are optimal for producing recombinant BA14K?

Based on published methodologies, E. coli expression systems have been successfully used for BA14K production. Specifically, E. coli strains M15 and BL21(DE3) have been employed with expression vectors such as pQE-30 UA .

The purification methodology typically involves:

  • Transforming the expression plasmid into the appropriate E. coli strain

  • Inducing protein expression with IPTG

  • Harvesting cells and preparing lysates

  • Purifying the recombinant protein using Ni-NTA agarose resin (for His-tagged constructs)

  • Confirming protein identity through Western blotting with anti-His monoclonal antibodies

  • Validating protein activity through functional assays such as immunoreactivity tests

What are the effects of gene disruption on Brucella phenotype and virulence?

Disruption of the gene encoding the 14-kDa protein in virulent B. abortus strain 2308 produces several significant effects :

  • Induction of a rough-like phenotype

  • Alteration of the smooth lipopolysaccharide (LPS) immunoblot profile

  • Significant reduction in the bacterium's ability to replicate in mouse spleens

Despite these effects, the mutant strain can still be stably maintained in mouse spleens at 2.0 to 2.6 log₁₀ CFU/spleen from day 1 to week 6 after intraperitoneal inoculation with 4.65 log₁₀ CFU .

Interestingly, in the rough attenuated strain RB51, disruption of the 14-kDa protein's gene has no effect on the mouse clearance pattern, suggesting strain-specific dependencies on this protein .

What immunological properties make BA14K significant for research?

BA14K demonstrates several key immunological properties that make it valuable for research :

  • Reactivity with antibodies from a variety of naturally and experimentally infected hosts

  • Ability to stimulate T lymphocytes from experimentally infected mice

  • Immunoglobulin binding properties based on its lectin-like characteristics

  • Specific immunogenicity in animals infected with Brucella species

  • Potential role in protective immunity against brucellosis

These properties suggest BA14K could serve as a non-LPS based antigen for diagnostic assays and potentially as a component in subunit vaccine development.

How does BA14K compare to LPS-based antigens for Brucella diagnostics?

The diagnostic superiority of BA14K compared to LPS-based antigens lies in its specificity. Conventional serological tests for brucellosis (RBPT, STAT, CFT) use antigens based on LPS or whole cells and are associated with false-positive results due to cross-reactions with other Gram-negative bacteria that have smooth LPS . Additionally, these tests cannot differentiate between vaccinated and naturally infected animals.

BA14K offers several advantages as a diagnostic antigen:

  • Increased specificity with fewer cross-reactions

  • Potential to differentiate between vaccinated and infected animals

  • Consistent yield through recombinant production methods

  • Standardized quality as a defined protein rather than a variable bacterial extract

These properties make BA14K attractive for developing more specific diagnostic assays for brucellosis .

What is the current evidence for BA14K's role in protective immunity?

While BA14K has been identified as immunogenic and reactive with both antibodies and T lymphocytes from infected hosts, direct evidence for its role in protective immunity remains under investigation . The protein's lectin-like properties and its essential contribution to virulence suggest it may be important in the host-pathogen interaction.

The fact that disruption of the BA14K gene significantly affects virulence indicates it may be a target for immune responses that contribute to protection . Studies employing BA14K are expected to contribute to better understanding the antigenic specificity of protective immunity to brucellosis .

What are the optimal methods for purifying recombinant BA14K?

Based on published methodologies, the following protocol represents an effective approach for purifying recombinant BA14K :

  • Expression System: Transform E. coli M15 or BL21(DE3) with an appropriate expression vector (such as pQE-30 UA) containing the BA14K gene.

  • Culture Conditions: Grow transformed bacteria in LB medium supplemented with appropriate antibiotics at 37°C.

  • Induction: Induce protein expression with IPTG (typically 0.5-1.0 mM) when culture reaches OD₆₀₀ of 0.6-0.8.

  • Cell Harvest: Collect cells by centrifugation after 4-6 hours of induction.

  • Lysis: Resuspend cell pellet in lysis buffer and disrupt cells by sonication or other mechanical methods.

  • Purification: For His-tagged recombinant BA14K:

    • Apply cleared lysate to Ni-NTA agarose resin

    • Wash with buffer containing low concentrations of imidazole

    • Elute with buffer containing high concentrations of imidazole (250-500 mM)

  • Dialysis: Remove imidazole by dialysis against appropriate buffer

  • Verification: Confirm protein identity by:

    • SDS-PAGE to check size and purity

    • Western blotting with anti-His monoclonal antibody

    • Functional assays (immunoreactivity, hemagglutination)

How can researchers effectively assess the hemagglutination and lectin-like properties of BA14K?

To assess the hemagglutination and lectin-like properties of BA14K, researchers can employ the following methodological approaches :

  • Hemagglutination Assay:

    • Prepare serial dilutions of purified BA14K in a 96-well V-bottom plate

    • Add a standardized suspension of red blood cells (typically 2% v/v)

    • Incubate at room temperature or 37°C for 1-2 hours

    • Record the highest dilution showing visible hemagglutination

  • Hemagglutination Inhibition Assay:

    • Pre-incubate BA14K with varying concentrations of potential inhibitors (mannose, glucose, galactose, etc.)

    • Add red blood cell suspension

    • Incubate and observe for inhibition of hemagglutination

    • This approach revealed BA14K's mannose specificity

  • Immunoglobulin Binding Assay:

    • Immobilize purified immunoglobulins on a solid phase

    • Add purified BA14K and detect binding using anti-BA14K antibodies or anti-His antibodies for recombinant tagged protein

    • Alternatively, immobilize BA14K and detect binding of added immunoglobulins

What are effective strategies for generating gene knockouts to study BA14K function?

Research indicates that gene disruption has been used to study BA14K function in Brucella . Based on methodologies in similar bacterial systems, the following approaches would be effective:

  • Homologous Recombination:

    • Generate a construct with antibiotic resistance cassette flanked by sequences homologous to regions upstream and downstream of the BA14K gene

    • Introduce this construct into Brucella cells via electroporation

    • Select for recombinants using appropriate antibiotics

    • Confirm gene disruption by PCR and Southern blotting

  • CRISPR-Cas9 System (for more precise genetic manipulation):

    • Design guide RNAs targeting the BA14K gene

    • Introduce CRISPR-Cas9 components and a repair template into Brucella

    • Select and verify mutants

  • Transposon Mutagenesis:

    • Use random transposon insertion libraries to identify BA14K mutants

    • Screen for altered phenotypes (rough colony morphology, reduced virulence)

    • Confirm insertion sites through sequencing

  • Phenotypic Analysis of resulting mutants should include:

    • Colony morphology assessment (smooth vs. rough)

    • LPS profile analysis by SDS-PAGE and immunoblotting

    • Virulence assessment in mouse infection models

    • Complementation studies to confirm phenotype is due to the specific gene disruption

How might the structure-function relationship of BA14K inform rational vaccine design?

Understanding the structure-function relationship of BA14K could significantly advance rational vaccine design. Currently, detailed structural information appears limited, but several research approaches would be valuable:

  • Structural Analysis: Determine the three-dimensional structure of BA14K through X-ray crystallography or NMR spectroscopy to identify:

    • The mannose-binding domain

    • Immunodominant epitopes

    • Regions critical for membrane association

  • Epitope Mapping: Identify B-cell and T-cell epitopes within BA14K that:

    • Are recognized by protective antibodies and T cells

    • Are conserved across Brucella species

    • Do not cross-react with human proteins

  • Structure-Based Design: Using the structural information:

    • Design peptide vaccines based on immunodominant epitopes

    • Create modified BA14K variants with enhanced immunogenicity

    • Develop chimeric antigens combining protective epitopes from BA14K with other Brucella immunogens

Given BA14K's high conservation across Brucella species and its role in virulence, targeting this protein could contribute to developing broadly protective vaccines against multiple Brucella species .

What is the precise molecular mechanism by which BA14K contributes to LPS synthesis and virulence?

The precise molecular mechanism by which BA14K contributes to LPS synthesis and virulence remains incompletely characterized, but research suggests important connections. Disruption of the BA14K gene induces a rough-like phenotype with altered smooth LPS profiles, indicating a role in LPS biosynthesis or assembly .

To elucidate this mechanism, several research approaches would be valuable:

  • Protein Interaction Studies:

    • Identify proteins that interact with BA14K using pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening

    • Focus on interactions with known LPS biosynthesis enzymes

  • Glycosyltransferase Activity Assessment:

    • Given the lectin-like properties, investigate whether BA14K possesses glycosyltransferase activity

    • Test whether it directly participates in polysaccharide synthesis or modification

  • Subcellular Localization Studies:

    • Confirm the membrane or periplasmic localization of BA14K

    • Determine whether it forms complexes with other membrane proteins involved in LPS export

  • Comparative Proteomics and Glycomics:

    • Compare proteomes and LPS profiles between wild-type and BA14K mutant strains

    • Identify specific changes in LPS structure resulting from BA14K absence

Understanding this mechanism could reveal new targets for therapeutic intervention against brucellosis.

How might BA14K interact with host immune components during infection?

The immunoreactivity and lectin-like properties of BA14K suggest it may have significant interactions with host immune components. Future research should investigate:

  • Interaction with Pattern Recognition Receptors (PRRs):

    • Determine whether BA14K is recognized by specific Toll-like receptors (TLRs) or C-type lectin receptors

    • Assess the downstream signaling pathways activated by these interactions

  • Effect on Antigen Presenting Cells:

    • Study how BA14K affects dendritic cell maturation and cytokine production

    • Determine its impact on antigen processing and presentation

  • Binding to Host Glycoproteins:

    • Given its mannose-binding properties, investigate interaction with mannose-containing host proteins

    • Determine whether these interactions affect bacterial adhesion, invasion, or immune evasion

  • T-cell Epitope Analysis:

    • Map and characterize T-cell epitopes within BA14K

    • Determine which epitopes stimulate protective vs. non-protective responses

These studies would provide insights into how BA14K contributes to Brucella pathogenesis and inform strategies for targeted interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.