Recombinant Brucella suis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
lspA; BSUIS_A0150; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
lspA
Target Protein Sequence
MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLALFRTHNEGIAFSMLAW LHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVVDYVL FHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella suis Lipoprotein signal peptidase (LspA) and why is it significant for research?

LspA is a type II signal peptidase that cleaves the signal peptide from prolipoproteins in Brucella suis after they've been modified by diacylglyceryl transferase (Lgt). This enzyme is essential for bacterial viability, making it a critical target for antimicrobial development. The significance of LspA stems from its central role in the pathway for lipoprotein maturation in Brucella suis, which contributes to bacterial pathogenesis, membrane integrity, and host immune responses . As lipoproteins from Brucella species can be exploited as potential vaccines against brucellosis, understanding LspA function is crucial for both basic bacterial physiology research and applied vaccine development .

How is LspA activity typically measured in laboratory settings?

Researchers commonly employ an SDS-PAGE gel-shift assay to measure LspA activity. In this methodology, a recombinant prepro inhibitor of cysteine protease (ppICP) representing the prepro-bacterial lipoprotein (ppBLP) is first converted by Lgt to pICP using dioleoylphosphatidylglycerol (DOPG) as the lipid substrate. LspA then cleaves the signal peptide (SP) from pICP, producing diacylated-ICP (DA-ICP), resulting in a measurable ~10 kDa molecular weight shift that can be tracked and quantified via SDS-PAGE . Inhibition of LspA activity can be quantified by measuring the signal intensity of the product DA-ICP on the gel. This assay provides a reliable method for screening potential LspA inhibitors and characterizing enzymatic activity under various experimental conditions.

What role does LspA play in Brucella suis pathogenesis?

LspA plays a critical role in Brucella suis pathogenesis through its function in lipoprotein processing. Properly processed bacterial lipoproteins contribute to membrane integrity, nutrient acquisition, and interactions with host cells. In Brucella species, lipoproteins have diverse functionality ranging from bacterial physiology to pathogenic processes . Specifically, lipoproteins processed by LspA may influence bacterial survival within host macrophages and modulate host immune responses. The enzyme's essentiality for bacterial viability makes it a potential target for controlling brucellosis infection. While specific lipoproteins processed by LspA in B. suis may serve as pathogen-associated molecular patterns (PAMPs) recognized by host pattern recognition receptors, some processed lipoproteins likely contribute to immune evasion mechanisms, allowing the bacterium to establish chronic infection.

How can computational approaches be used to design inhibitors targeting B. suis LspA?

Computational approaches to design inhibitors targeting B. suis LspA typically begin with structural analysis of the enzyme and its active site. Using techniques such as molecular docking, researchers can screen virtual libraries of compounds against the LspA structure to identify potential inhibitors. Structure-based drug design approaches have successfully yielded compounds like "G2a" and "G2d" that specifically inhibit LspA activity . Advanced computational techniques might include molecular dynamics simulations to understand protein-ligand interactions, quantum mechanical calculations to optimize binding energies, and machine learning algorithms to predict inhibitor efficacy. The design process can benefit from leveraging knowledge of natural LspA inhibitors such as globomycin as structural templates, while incorporating modifications to enhance specificity for B. suis LspA. Validation of computationally designed inhibitors requires experimental confirmation using assays like the SDS-PAGE gel-shift method to measure inhibition of enzymatic activity.

What are the challenges in expressing and purifying recombinant B. suis LspA for structural studies?

Expressing and purifying recombinant B. suis LspA presents several significant challenges due to its nature as a membrane-associated enzyme. As a transmembrane protein, LspA contains hydrophobic domains that can cause protein aggregation and inclusion body formation during heterologous expression. Researchers must optimize expression systems (bacterial, yeast, or insect cells) by using fusion tags that enhance solubility (such as maltose-binding protein or thioredoxin) and membrane-mimetic environments during purification. Detergent selection is critical, as it must solubilize LspA without denaturing it; common choices include n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). Temperature optimization during expression (typically lowered to 16-20°C) and induction conditions require careful calibration. For structural studies, researchers must achieve protein that is not only pure but properly folded and functionally active, necessitating activity assays at each purification step. Crystallization attempts often require extensive screening of conditions and potentially the use of antibody fragments or nanobodies to stabilize flexible regions of the protein.

How does genetic variation in LspA across Brucella suis strains affect inhibitor development?

Genetic variation in LspA across Brucella suis strains can significantly impact inhibitor development strategies. While the catalytic core of LspA tends to be conserved due to its essential function, variations in amino acid sequences can affect inhibitor binding affinity and specificity. Researchers developing LspA inhibitors must account for potential polymorphisms by targeting highly conserved regions of the enzyme. Comparative genomic analysis of LspA sequences from multiple B. suis isolates, particularly those from different biovars (1-5), is essential to identify conservation patterns . Structure-activity relationship studies of inhibitors should include testing against LspA variants to ensure broad-spectrum activity. In some cases, variations in the enzyme's substrate-binding pocket might necessitate the development of biovar-specific inhibitors. Additionally, researchers should consider that some B. suis strains might have developed mechanisms to compensate for partial LspA inhibition through altered expression of related pathways. A comprehensive approach would include creating a database of LspA sequence variations correlated with inhibitor sensitivity to guide rational drug design efforts.

What are the optimal conditions for expressing recombinant B. suis LspA in E. coli expression systems?

Optimizing expression of recombinant B. suis LspA in E. coli requires careful consideration of multiple parameters. Most successful protocols utilize E. coli BL21(DE3) or C41(DE3) strains specifically designed for membrane protein expression. The gene sequence should be codon-optimized for E. coli and cloned into vectors with tunable promoters like pET or pBAD series. Expression constructs should incorporate an N-terminal fusion tag (His6, MBP, or SUMO) to aid purification while avoiding C-terminal tags that might interfere with membrane insertion. Induction conditions are critical: cultures should be grown to mid-log phase (OD600 ~0.6) at 37°C, then shifted to 16-18°C before adding a reduced concentration of inducer (0.1-0.2 mM IPTG or 0.002% arabinose) for overnight expression. Media supplementation with 0.5-1% glucose during initial growth helps repress basal expression, while addition of 1% glycerol during induction can improve membrane protein folding. After harvesting, cells should be lysed in buffers containing 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors. Membrane fractions must be solubilized using detergents like DDM (1%) or LMNG (0.5-1%), with subsequent purification via affinity chromatography performed at 4°C to maintain protein stability.

How can researchers develop a reliable assay to screen potential inhibitors of B. suis LspA?

Developing a reliable assay for screening B. suis LspA inhibitors requires a systematic approach that balances throughput with physiological relevance. The SDS-PAGE gel-shift assay represents a foundation for inhibitor screening, where researchers can quantify the conversion of prolipoprotein to mature lipoprotein in the presence of candidate inhibitors . For higher throughput, researchers should develop fluorescence-based assays using synthetic peptide substrates that mimic the LspA cleavage site, where successful cleavage results in fluorescence emission through FRET (Förster resonance energy transfer) or similar approaches. Assay conditions must be optimized for buffer composition (typically phosphate or Tris-based, pH 7.5-8.0), detergent concentration to maintain LspA solubility without interfering with activity, and substrate concentration to operate within the linear range of enzyme kinetics. A reliable screening cascade would include: (1) primary screening using the fluorescence-based assay, (2) confirmation of hits via the gel-shift assay, and (3) validation of specificity by testing against other signal peptidases. Counter-screens against mammalian proteases should be included to assess selectivity. For compound evaluation, researchers should determine IC50 values and conduct mechanism of action studies to distinguish between competitive, non-competitive, or irreversible inhibition. Finally, cellular assays using B. suis cultures or infection models can confirm whether inhibitors penetrate bacterial membranes and retain activity in physiological contexts.

What techniques can be used to study the structure-function relationship of B. suis LspA?

Elucidating the structure-function relationship of B. suis LspA requires a multi-faceted approach combining structural biology, biochemistry, and molecular genetics. X-ray crystallography remains the gold standard for determining high-resolution structures, though crystallizing membrane proteins like LspA presents significant challenges. Cryo-electron microscopy (cryo-EM) offers an alternative approach that has advanced significantly for membrane proteins. For functional analysis, site-directed mutagenesis of conserved residues (particularly the predicted catalytic dyad/triad) coupled with activity assays can identify essential amino acids. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal dynamic regions and conformational changes upon substrate or inhibitor binding. Molecular dynamics simulations complement experimental approaches by modeling protein motions and predicting effects of mutations. Chimeric constructs swapping domains between LspA homologs from different species can identify regions responsible for substrate specificity. Cross-linking studies combined with mass spectrometry can map interaction surfaces with substrates or binding partners. For in vivo relevance, conditional knockout strains of B. suis expressing LspA variants can assess the impact of specific mutations on bacterial viability and virulence. Together, these approaches provide comprehensive insights into how LspA structure dictates its function in lipoprotein processing.

How can researchers address the discrepancy between in vitro inhibition of B. suis LspA and in vivo efficacy?

Addressing discrepancies between in vitro LspA inhibition and in vivo efficacy requires systematic investigation of multiple factors affecting drug action in the bacterial environment. Researchers should first examine compound membrane permeability using liposome-based assays or accumulation studies with radiolabeled compounds in B. suis cells. Bacterial efflux mechanisms may reduce intracellular concentrations of inhibitors; testing in the presence of efflux pump inhibitors can reveal if this is occurring. Protein binding in biological fluids can sequester compounds, reducing free drug concentration available for target engagement; this should be evaluated through plasma protein binding assays. The intracellular niche of B. suis presents another challenge, as compounds must penetrate host cell membranes to reach bacteria residing in macrophages. Researchers should develop cellular infection models using macrophages infected with B. suis to test inhibitor efficacy in this context. Pharmacokinetic and pharmacodynamic studies are essential to ensure adequate drug exposure at the site of infection. Additionally, combination studies with established antibiotics may reveal synergistic effects that enhance in vivo efficacy. If metabolic stability is an issue, medicinal chemistry efforts to optimize compound stability while maintaining target affinity should be pursued. Finally, testing against clinical isolates rather than laboratory strains provides more relevant data for translational potential.

What are the limitations of current detection methods for B. suis infection, and how might LspA-based approaches improve diagnosis?

Current detection methods for B. suis infection face several limitations that LspA-based approaches could potentially address. Serological tests for brucellosis have lower sensitivity in swine compared to other host species, often necessitating herd-level rather than individual testing . This reduced sensitivity may result from structural differences between B. abortus and B. suis lipopolysaccharides (LPS), as most serologic tests were developed for B. abortus infections in cattle . Additionally, studies have shown that some feral swine culture-positive for Brucella spp. do not develop detectable antibodies, creating false negatives in surveillance programs . LspA-based diagnostic approaches could improve detection through several mechanisms. First, development of assays detecting LspA-processed lipoproteins specific to B. suis might provide greater specificity than current LPS-based tests. Second, direct detection of LspA enzymatic activity in clinical samples could indicate active infection rather than past exposure. Molecular approaches targeting LspA gene sequences through PCR could enable species-specific identification of B. suis. Furthermore, understanding genetic variations in immune-related genes like AOAH, ELMO1, and LYN - which have been associated with differential antibody responses to B. suis infection - could help interpret serological results more accurately and identify animals at higher risk of infection or transmission.

How can genetic variation in host immune response genes affect B. suis infection outcomes and experimental reproducibility?

Genetic variation in host immune response genes significantly impacts B. suis infection outcomes and experimental reproducibility. Studies of feral swine have identified specific loci associated with differential antibody responses to B. suis infection despite bacterial presence . Single-locus genome-wide association studies revealed eight loci on chromosomes 4, 8, 9, 10, 12, and 18 associated with seroconversion, implicating genes involved in immune function, particularly phagocytosis and inflammatory responses . Key genes identified include AOAH (Acyloxyacyl hydrolase), which processes bacterial lipopolysaccharides; ELMO1 (Engulfment and Cell Motility 1), involved in phagocytosis and T cell responses; and LYN, which regulates B cell receptor signaling . These genetic variations create several challenges for researchers: (1) variable antibody responses can cause inconsistent results in serological testing, (2) experimental models using genetically homogeneous animals may not capture the diversity of immune responses seen in natural hosts, and (3) vaccine development studies may show differential efficacy based on host genetics. To address these challenges, researchers should consider genotyping experimental animals for key immune response genes, stratifying results based on genetic profiles, and utilizing diverse genetic backgrounds in animal models. Additionally, experiments involving B. suis infection should include both serological and direct detection methods, as some infected animals may not produce detectable antibodies despite harboring the bacteria. Understanding these host genetic factors is essential for developing accurate diagnostic approaches and effective control strategies for brucellosis.

What potential exists for developing B. suis LspA inhibitors as novel therapeutic agents against brucellosis?

The development of B. suis LspA inhibitors as therapeutic agents shows significant promise due to several favorable characteristics of this target. First, LspA is essential for bacterial viability, making it an attractive antibiotic target with potentially bactericidal activity . Recent computational design efforts have successfully created cyclic peptide inhibitors like compounds G2a and G2d that specifically inhibit LspA activity . These compounds demonstrated inhibition of LspA function in vitro, suggesting a foundation for therapeutic development. The natural product globomycin, which inhibits LspA function, provides a structural template for designing more specific inhibitors against B. suis LspA . Given the conservation of LspA across bacterial pathogens but its absence in mammalian cells, targeting this enzyme offers the potential for broad-spectrum antibacterial activity with minimal host toxicity. Future research should focus on optimizing lead compounds for improved pharmacokinetic properties, enhancing membrane permeability to access intracellular bacteria, and demonstrating efficacy in animal models of brucellosis. Combination therapy approaches with existing antibiotics should be investigated to prevent resistance development and potentially shorten treatment duration. Challenges to address include optimizing selectivity for bacterial over mammalian enzymes, achieving adequate tissue distribution to reach bacteria in their intracellular niche, and developing formulations suitable for oral administration to facilitate treatment in both humans and animals affected by brucellosis.

How might systems biology approaches enhance our understanding of the role of LspA in B. suis pathogenesis?

Systems biology approaches offer powerful tools to elucidate the complex role of LspA in B. suis pathogenesis. Multi-omics integration combining transcriptomics, proteomics, and lipidomics of wild-type versus LspA-depleted strains can identify the complete lipoprotein repertoire processed by LspA and assess global changes in bacterial physiology when this processing is compromised. Network analysis can map interactions between LspA-processed lipoproteins and host proteins, revealing potential immune evasion mechanisms. Genome-scale metabolic modeling incorporating lipoprotein function can predict metabolic vulnerabilities created by LspA inhibition. Single-cell techniques applied to infected macrophages can reveal heterogeneity in bacterial responses and host-pathogen interactions. Computational models integrating host genomic factors - particularly genes like AOAH, ELMO1, and LYN identified in GWAS studies - with bacterial lipoprotein processing can predict infection outcomes based on host-pathogen genetic interactions. Dual RNA-seq of both host and pathogen during infection can track dynamic transcriptional changes during different stages of infection. In vitro organ-on-chip or 3D cell culture systems can provide more physiologically relevant models to study LspA function in tissue-specific microenvironments. These approaches collectively would create a comprehensive understanding of how LspA-mediated lipoprotein processing contributes to bacterial survival strategies, host immune responses, and ultimately clinical outcomes in brucellosis. This systems-level insight would inform more targeted therapeutic approaches and identify potential biomarkers for disease progression.

What role might LspA-processed lipoproteins play in the development of next-generation vaccines against B. suis?

LspA-processed lipoproteins represent promising candidates for next-generation vaccines against B. suis due to their surface exposure and immunogenic properties. Bacterial lipoproteins from Brucella are already being exploited as potential vaccines to countermeasure brucellosis infection . These membrane proteins, anchored peripherally by LspA-mediated processing, present epitopes accessible to the host immune system. Future vaccine development could take several approaches: (1) Subunit vaccines using purified recombinant lipoproteins processed by LspA, potentially combined in multi-antigen formulations to broaden protection; (2) Live attenuated strains with modified lipoprotein processing that maintain immunogenicity while reducing virulence; (3) DNA vaccines encoding immunodominant lipoproteins to stimulate both humoral and cell-mediated immunity; and (4) Vectored vaccines using viral or bacterial vectors to deliver Brucella lipoprotein antigens. Researchers must consider host genetic factors that influence antibody responses, as studies in feral swine have shown that genetic variations in genes like AOAH affect immune responses to B. suis . Understanding the differential processing of lipoproteins across Brucella biovars will be essential for developing broadly protective vaccines. Additionally, adjuvant selection should account for the specific immune responses required for protection against intracellular pathogens like B. suis. Vaccine candidates should be evaluated not only for antibody production but also for their ability to stimulate cell-mediated immunity, particularly IFN-γ-producing CD4+ T cells (TH1 responses), which are critical for controlling Brucella infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.