Recombinant Brucella suis NADH-quinone oxidoreductase subunit K (nuoK)

What is Brucella suis NADH-quinone oxidoreductase subunit K (nuoK) and its basic structural features?

Brucella suis NADH-quinone oxidoreductase subunit K (nuoK) is a small membrane protein component of the NADH-quinone oxidoreductase complex (also known as Complex I) in the electron transport chain of Brucella suis. The protein consists of 102 amino acids with a complete sequence of: MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVGQVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG .

The nuoK protein is highly hydrophobic with multiple transmembrane domains, which is characteristic of its role as an integral membrane component of the respiratory chain complex. The protein contains conserved residues critical for proton pumping and electron transfer functions that are typical of NADH dehydrogenase subunits. Structural analysis indicates that nuoK contributes to the membrane domain of Complex I, which is essential for energy conservation in bacterial systems .

What expression systems are recommended for recombinant production of Brucella suis nuoK?

Multiple expression systems have been validated for the recombinant production of Brucella suis nuoK protein, each with distinct advantages depending on the research application:

For most laboratory research applications, E. coli expression systems represent the optimal balance of yield, cost, and time efficiency for the production of functional recombinant nuoK protein . When using E. coli, the protein is typically fused to an N-terminal His-tag to facilitate purification, as demonstrated in the commercially available preparations .

How should recombinant Brucella suis nuoK be stored and handled for optimal stability?

Recombinant Brucella suis nuoK requires specific storage and handling conditions to maintain structural integrity and functional activity. Based on established protocols, the following recommendations should be implemented:

• The lyophilized protein should be stored at -20°C to -80°C upon receipt .

• Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Addition of 5-50% glycerol as a cryoprotectant (with 50% being optimal) is recommended for long-term storage .

• Aliquoting the reconstituted protein is essential to avoid repeated freeze-thaw cycles, which significantly reduce protein stability and activity .

• Working aliquots may be stored at 4°C for up to one week to minimize degradation from temperature fluctuations .

For membrane proteins like nuoK, the addition of mild detergents during reconstitution may improve solubility without compromising structure. Tris/PBS-based buffers at pH 8.0 containing 6% trehalose have been demonstrated to enhance stability during storage .

What purification strategies yield the highest purity for recombinant Brucella suis nuoK?

Purification of recombinant Brucella suis nuoK presents specific challenges due to its hydrophobic nature and multiple transmembrane domains. The following methodological approach has been optimized for high purity isolation:

• Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary method for isolating His-tagged nuoK protein from crude lysate .

• Detergent Selection: Critical for membrane protein solubilization - mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.1-0.5% concentration maintain protein integrity while solubilizing nuoK from membranes.

• Intermediate Purification: Ion exchange chromatography using a salt gradient elution helps remove contaminating proteins with different charge properties.

• Polishing Step: Size exclusion chromatography separates monomeric nuoK from aggregates and other impurities.

• Quality Control: SDS-PAGE analysis confirms purity >90%, which is the minimum standard for structural and functional studies .

This multi-step purification protocol typically yields 2-5 mg of purified protein per liter of E. coli culture, with purity exceeding 90% as determined by SDS-PAGE analysis .

How can researchers validate the functional activity of purified recombinant Brucella suis nuoK?

Validating the functional activity of recombinant nuoK requires specialized assays that assess both structural integrity and biochemical function:

• Circular Dichroism Spectroscopy: Confirms proper secondary structure formation, particularly the alpha-helical content expected in membrane proteins.

• NADH Oxidation Assay: Measures electron transfer capability when incorporated into proteoliposomes with other Complex I components.

• Membrane Potential Measurements: Assesses proton pumping activity using fluorescent probes sensitive to membrane potential changes.

• Thermal Stability Analysis: Differential scanning fluorimetry can determine protein stability under various conditions.

• Protein-Protein Interaction Studies: Pull-down assays or surface plasmon resonance to confirm binding to other Complex I subunits.

When validating recombinant nuoK for immunological studies, additional testing should include Western blot analysis using anti-Brucella antibodies to confirm antigenic epitope preservation, which is critical for vaccine development applications .

What are the critical considerations for experimental design when evaluating nuoK as a vaccine candidate?

When designing experiments to evaluate Brucella suis nuoK as a potential vaccine candidate, researchers should implement a systematic approach addressing the following critical factors:

• Antigen Formulation: Determining optimal presentation format:

  • Purified recombinant protein with appropriate adjuvants

  • DNA vaccine encoding nuoK

  • Live vector expressing nuoK

  • Incorporation into outer membrane vesicles

• Immunogenicity Assessment:

  • Measurement of antibody titers (IgG, IgA, IgM)

  • T-cell responses (CD4+ and CD8+ activation)

  • Cytokine profiles (Th1/Th2/Th17 balance)

  • Mucosal immunity evaluation

• Challenge Studies Design:

  • Selection of appropriate animal models (mice, guinea pigs)

  • Determination of challenge dose and route

  • Quantitative bacterial burden assessment in tissues

  • Histopathological evaluation

• Safety Evaluation:

  • Local and systemic adverse reactions

  • Persistence of immunity without disease exacerbation

  • Cross-reactivity with host proteins

  • Stability of attenuated strains if used as vectors

• Comparative Analysis:

  • Side-by-side comparison with existing vaccine candidates

  • Combination with other Brucella antigens to assess synergistic effects

Since Brucella is a zoonotic pathogen, vaccine development requires stringent biosafety protocols and ethical considerations. All products used in such research should be strictly limited to laboratory investigation and cannot be directly used in humans or animals without proper regulatory approval .

How does whole-genome sequencing contribute to understanding nuoK variation and Brucella suis transmission?

Whole-genome sequencing (WGS) has revolutionized the investigation of Brucella suis transmission and the identification of genetic variations in key proteins including nuoK. A notable application of this technology was demonstrated in a case where WGS was used to determine the geographical origin of a Brucella suis infection in a patient from Tonga living in Oregon, USA .

The methodology for applying WGS to nuoK variation analysis involves:

• Sequencing Protocol: Illumina MiSeq platform using 2×250 paired-end reads typically generates 12–30× coverage for comprehensive SNP detection .

• Bioinformatic Analysis:

  • Raw reads mapped to reference genome using Burrows-Wheeler Aligner

  • SNP calling performed using tools like UnifiedGenotyper

  • Filtering with minimum Phred quality score (300) and allele count (2)

  • Maximum-likelihood phylogenetic trees constructed using RAxML

• Comparative Genomics:

  • Identification of single nucleotide polymorphisms (SNPs) in nuoK across isolates

  • Analysis of conservation patterns in functional domains

  • Detection of selection pressure on specific amino acid residues

In the documented case study, WGS analysis revealed that the patient's isolate clustered with samples from Tonga rather than US strains, with approximately 60 SNPs separating the clades . This level of resolution allowed investigators to conclude that infection occurred before immigration to the US, averting unnecessary agricultural investigations and trade restrictions .

This approach demonstrates how nuoK genetic diversity can be mapped across geographical regions, potentially identifying functionally significant variations that may impact virulence, transmission, or vaccine efficacy.

What structural and functional differences exist between nuoK proteins across Brucella species?

Comparative analysis of nuoK across Brucella species reveals both conserved features essential for respiratory function and species-specific variations that may contribute to host adaptation and pathogenicity:

For cross-species comparative research, recombinant proteins should be expressed under identical conditions to minimize experimental variables when assessing functional differences. When designing broad-spectrum vaccines targeting nuoK, researchers should focus on the most conserved epitopes to ensure cross-protection against multiple Brucella species .

How does the Brucella suis nuoK protein compare with homologous proteins in other pathogenic bacteria?

Comparative analysis of Brucella suis nuoK with homologous proteins in other bacterial pathogens reveals evolutionary relationships and functional conservation patterns that can inform therapeutic targeting strategies:

The nuoK protein from Brucella suis shares structural and functional similarities with homologous proteins in other bacteria, although with varying degrees of sequence conservation. For example, the nuoK protein from Klebsiella pneumoniae (another pathogenic bacterium) also functions as part of the NADH-quinone oxidoreductase complex and has a similar length of approximately 100 amino acids .

Key comparative insights include:

This comparative understanding enables:

• Identification of universal bacterial targets for broad-spectrum antimicrobials

• Design of species-specific inhibitors targeting unique features of Brucella nuoK

• Development of diagnostic tools that can differentiate between bacterial infections

Research approaches that leverage these comparisons include structural biology studies, molecular dynamics simulations, and cross-species complementation experiments to determine functional conservation .

What are the challenges in developing antibodies against Brucella suis nuoK for diagnostic applications?

Developing effective antibodies against Brucella suis nuoK for diagnostic applications presents several technical challenges that require specialized approaches:

• Membrane Protein Antigenicity Issues:

  • Limited exposure of antigenic epitopes due to membrane embedding

  • Conformational epitopes may be lost in recombinant preparations

  • Detergent solubilization can mask important antigenic determinants

• Immunization Strategy Considerations:

  • Traditional approaches using purified protein often yield poor responses

  • Peptide-based approaches may miss conformational epitopes

  • DNA immunization or cell-based presentation may better preserve native structure

• Cross-Reactivity Concerns:

  • Sequence similarity with nuoK from other bacteria may reduce specificity

  • Potential for cross-reaction with host mitochondrial complex I components

  • Discriminating between Brucella species requires targeting variable regions

• Validation Methodology Requirements:

  • Need for confirmed negative and positive control samples

  • Standardization across different test formats (ELISA, lateral flow, etc.)

  • Determination of appropriate sensitivity and specificity thresholds

• Antibody Production Optimization:

  • Selection between polyclonal, monoclonal, or recombinant antibody approaches

  • Humanization requirements for therapeutic applications

  • Scale-up considerations for diagnostic kit development

Successful antibody development typically employs a combination of approaches, including the use of synthetic peptides corresponding to predicted surface-exposed regions of nuoK, genetic immunization with DNA constructs, and screening against multiple Brucella species to ensure specificity .

How can recombinant Brucella suis nuoK be utilized in serodiagnostic assays for brucellosis?

Recombinant Brucella suis nuoK protein offers significant potential for improving serodiagnostic assays for brucellosis, particularly in differentiating between vaccinated and infected animals or humans. The methodological approach for developing such assays includes:

• Antigen Preparation Protocol:

  • Expression of full-length (1-102 aa) His-tagged nuoK protein in E. coli

  • Purification to >90% purity using IMAC followed by size exclusion chromatography

  • Quality control via SDS-PAGE and Western blot analysis

  • Stabilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Assay Development Strategy:

  • ELISA platform optimization (direct, indirect, or sandwich format)

  • Determination of optimal antigen concentration (typically 1-5 μg/mL)

  • Selection of blocking agents to minimize background

  • Validation of secondary antibody specificity

• Performance Evaluation:

  • Sensitivity and specificity determination using reference panels

  • Cross-reactivity assessment with other bacterial infections

  • Reproducibility testing across different laboratories

  • Shelf-life and stability studies under various storage conditions

• Clinical Validation:

  • Testing against well-characterized serum banks

  • Comparison with gold standard methods (culture, Rose Bengal test)

  • Determination of positive predictive value in different prevalence settings

  • Assessment of performance in various host species (humans, cattle, swine)

The advantage of recombinant nuoK-based assays lies in their potential specificity, as this protein may present epitopes that are highly specific to Brucella suis compared to other Brucella species or cross-reacting bacteria. Additionally, the ability to produce consistently pure antigen in large quantities enables standardization across diagnostic platforms .

What evidence supports the potential of nuoK as a vaccine antigen against Brucella suis infection?

The evaluation of Brucella suis nuoK as a vaccine antigen candidate is supported by several lines of evidence, though research in this specific area remains in early stages:

• Theoretical Basis for Vaccine Potential:

  • As an essential component of the respiratory chain, nuoK represents a critical survival factor for Brucella

  • Membrane localization makes epitopes potentially accessible to immune recognition

  • Conservation across Brucella species suggests potential for cross-protection

• Immunogenicity Evidence:

  • Recombinant nuoK has been demonstrated to elicit both humoral and cell-mediated immune responses in experimental models

  • As part of the electron transport chain, interference with nuoK function could inhibit bacterial metabolism

  • The protein contains predicted T-cell and B-cell epitopes based on computational analysis

• Technical Advantages as Vaccine Component:

  • Well-established protocols exist for recombinant production

  • Can be combined with other Brucella antigens in multi-epitope vaccines

  • Amenable to various delivery platforms (protein-based, DNA, viral vectors)

• Limitations and Research Gaps:

  • Limited in vivo protection data specifically for nuoK as a standalone antigen

  • Optimal formulation and delivery route remain to be determined

  • Need for adjuvant optimization to enhance immunogenicity

• Comparative Effectiveness:

  • Preliminary data suggests nuoK may complement other established vaccine antigens

  • May provide additive protection when combined with immunodominant antigens

It's important to note that while nuoK shows theoretical promise, vaccine development requires extensive validation through animal models before advancing to clinical testing. Current research appears focused on characterizing the recombinant protein and establishing production methods, which are prerequisite steps in the vaccine development pipeline .

What emerging technologies could advance structural studies of Brucella suis nuoK?

Recent technological advances offer new opportunities to overcome the historical challenges in studying membrane proteins like Brucella suis nuoK:

• Cryo-Electron Microscopy Advancements:

  • Single-particle analysis at near-atomic resolution without crystallization

  • Visualization of nuoK in the context of the complete NADH-quinone oxidoreductase complex

  • Time-resolved structural transitions during electron transport

• Integrative Structural Biology Approaches:

  • Combining NMR spectroscopy with computational modeling

  • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Cross-linking mass spectrometry to map protein-protein interactions

• Nanodiscs and Lipid Cubic Phase Technologies:

  • Novel membrane mimetics that better preserve native protein conformation

  • Improved stability for structural and functional studies

  • Potential for direct visualization of lipid-protein interactions

• Artificial Intelligence Applications:

  • AlphaFold2 and similar AI tools for improved structure prediction

  • Machine learning approaches to identify functional motifs

  • Computational screening of potential inhibitors targeting nuoK

• Single-Molecule Techniques:

  • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

  • Atomic force microscopy for topological mapping of membrane integration

  • Optical tweezers to measure force generation during proton pumping

These emerging technologies could provide unprecedented insights into nuoK structure-function relationships, potentially revealing novel druggable sites and informing rational vaccine design approaches. The integration of these methods would address the current knowledge gaps regarding how nuoK contributes to Brucella pathogenesis and survival under different environmental conditions .

What research gaps must be addressed to better understand nuoK's role in Brucella suis pathogenesis?

Several critical knowledge gaps remain in our understanding of nuoK's contribution to Brucella suis pathogenesis and host-pathogen interactions:

• Functional Role During Infection Cycle:

  • How nuoK activity changes during different stages of infection

  • Whether host factors directly interact with or modulate nuoK function

  • The impact of nuoK on intracellular survival within macrophages

• Metabolic Adaptation Mechanisms:

  • How nuoK contributes to bacterial adaptation to low oxygen environments

  • The role of nuoK in maintaining energy homeostasis during stress conditions

  • Potential compensatory mechanisms when nuoK function is compromised

• Host Immune Recognition:

  • Whether nuoK-specific immune responses develop during natural infection

  • If nuoK epitopes are presented to the host immune system

  • How nuoK-targeting antibodies might affect bacterial viability

• Genetic Regulation:

  • Transcriptional control mechanisms governing nuoK expression

  • Post-translational modifications affecting nuoK function

  • Genetic polymorphisms across clinical isolates and their functional significance

• Therapeutic Targeting Potential:

  • Druggability assessment of nuoK as an antimicrobial target

  • Development of specific inhibitors and evaluation of their efficacy

  • Potential for synergy with other therapeutic approaches

Addressing these research gaps requires multidisciplinary approaches combining genetic manipulation (gene deletion, site-directed mutagenesis), advanced imaging techniques to track nuoK localization during infection, transcriptomic and proteomic profiling under various conditions, and in vivo infection models to assess the impact of nuoK modulation on virulence .

How might systems biology approaches enhance our understanding of nuoK in the context of Brucella metabolism?

Systems biology approaches offer powerful frameworks for understanding nuoK's role within the broader context of Brucella metabolism and pathogenesis:

• Multi-omics Integration Strategies:

  • Combining transcriptomics, proteomics, and metabolomics data to create comprehensive models

  • Flux balance analysis to quantify metabolic shifts when nuoK is perturbed

  • Network analysis to identify critical nodes connecting respiratory function with virulence

• Genome-Scale Metabolic Models:

  • In silico prediction of growth phenotypes under various conditions

  • Identification of synthetic lethal interactions with nuoK

  • Simulation of metabolic adaptation during host infection

• Interspecies Comparative Systems Analysis:

  • Cross-species comparison of nuoK-centered networks

  • Identification of conserved and divergent regulatory patterns

  • Evolutionary analysis of respiratory chain adaptations

• Host-Pathogen Interaction Modeling:

  • Dual-organism models capturing metabolic crosstalk

  • Prediction of critical interaction points amenable to therapeutic intervention

  • Simulating immune system effects on bacterial metabolism

• Experimental Validation Approaches:

  • CRISPR interference for temporal control of nuoK expression

  • Metabolic labeling to track carbon flux through respiratory pathways

  • Real-time monitoring of membrane potential in mutant strains

These systems-level approaches would provide a more holistic understanding of how nuoK contributes to Brucella fitness and virulence beyond its immediate role in electron transport. The resulting integrated knowledge could identify non-obvious intervention points for therapeutic development and reveal condition-specific dependencies that could be exploited for pathogen control .