Recombinant Brucella suis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

General Information

Brucella suis is a bacterium that can infect animals and humans, causing brucellosis . The genome of B. suis has been sequenced and analyzed, revealing similarities with both animal and plant pathogens . This bacterium employs various mechanisms to survive and replicate within host cells, including the modulation of host cell processes and expression of virulence factors .

Genomic Context and Comparative Genomics

The genome sequence of Brucella suis has a size of 3.31 Mb . A comparison of the B. suis genome with that of Brucella melitensis revealed extensive similarity and gene synteny . The majority of B. suis and B. melitensis genes share 98–100% identity at the nucleotide level .

B. suis is closely related to other alpha-proteobacteria, including animal pathogens like Bartonella spp. and plant-associated bacteria like Agrobacterium tumefaciens . Analysis of the predicted B. suis proteins shows significant similarity to those of species in the Rhizobium/Agrobacterium group .

Role and Function of HtpX

HtpX is a protease homolog present in Brucella suis . Proteases like HtpX are involved in various cellular processes, including protein turnover, stress response, and virulence .

Virulence and Host Interactions

Brucella species, including B. suis, are intracellular pathogens that can infect macrophages . Within macrophages, Brucella can induce an unfolded protein response (UPR), which is a cellular stress response . Additionally, Brucella can modulate host cell signaling pathways to promote its survival and replication . For example, Brucella targets host USP8 through the effector protein TcpB to manipulate the host's cellular environment .

Potential Antigenic Peptides

Proteomic and peptidomic analyses of Brucella have identified potential antigenic peptides that could bind to MHC molecules . These peptides may be good candidates for designing subunit vaccines against Brucella .

Research Findings

  • Genome Sequencing: The genome of Brucella suis has been sequenced, providing insights into its genetic makeup and relationship to other bacteria .

  • Comparative Genomics: Comparison of the B. suis genome with those of other bacteria has revealed similarities with both animal and plant pathogens .

  • Virulence Factors: Brucella suis possesses virulence factors that contribute to its ability to infect and persist within host cells .

  • Host Interactions: Brucella interacts with host cells, including macrophages, to establish infection and modulate host cell processes .

  • Antigenic Peptides: Proteomic and peptidomic analyses have identified potential antigenic peptides that could be used in vaccine design .

Data Tables

As supplementary material, the original papers include tables of data. For example, one study includes a table of SNPs between B. suis and B. melitensis . Another study includes analysis of genes that showed changes in expression .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
htpX; BSUIS_B1291; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella suis (strain ATCC 23445 / NCTC 10510)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFAAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is HtpX protease and what is its significance in Brucella suis?

    HtpX is a membrane-bound zinc metalloprotease that plays a critical role in protein quality control and stress response in bacteria. In Brucella species, it contributes to bacterial survival under stress conditions by degrading misfolded or damaged membrane proteins. Within the context of Brucella pathogenesis, HtpX likely participates in maintaining membrane integrity during intracellular replication, which occurs within the endoplasmic reticulum-derived compartments of host cells. Similar to other bacterial systems, Brucella HtpX is thought to be involved in protein homeostasis during environmental stress conditions encountered within the host.

    For experimental work, researchers should consider examining HtpX expression during different stages of infection, particularly during the transition from the early endocytic network to the replicative niche within the rough endoplasmic reticulum compartment, as described in Brucella intracellular trafficking studies .

  • How conserved is the htpX gene across Brucella species?

    The htpX gene demonstrates high conservation across Brucella species, reflecting its fundamental role in bacterial physiology. Comparative genomic analyses reveal sequence homology exceeding 98% at the nucleotide level among B. melitensis, B. abortus, and B. suis. This conservation suggests functional importance throughout the genus.

    To investigate conservation experimentally:

    • Perform multiple sequence alignments of htpX genes from different Brucella species

    • Assess conservation at both nucleotide and amino acid levels

    • Evaluate synteny of genomic regions surrounding htpX

    • Consider using whole-genome microarray approaches as described for other Brucella genes to assess expression patterns across species

    Conservation analysis can help determine whether functional studies in one species (such as B. melitensis) can be extrapolated to other species like B. suis.

  • What experimental models are most appropriate for studying HtpX function in Brucella suis?

    Several experimental models can be employed to study HtpX function in Brucella suis:

    Cellular models:

    • HeLa S3 cell lines (passages 8-15) grown in F12K medium with 10% heat-inactivated fetal bovine serum at 37°C with 5% CO₂

    • Baby hamster kidney (BHK-21) cells cultured in GMEM supplemented with 10% Tryptose Phosphate Broth and 5% fetal calf serum

    Infection protocols:

    • Centrifugation of bacteria onto cells at 400g for 10 min at 4°C, followed by incubation at 37°C under 5% CO₂

    • Washing cells with culture medium to remove extracellular bacteria

    • Gentamicin treatment (50 μg/mL initially, then reduced to 10 μg/mL) to eliminate remaining extracellular bacteria

    RNA isolation from infected cells:

    • Cell lysis using 1% Triton at room temperature

    • Enzymatic digestion of host RNA/DNA using DNase and RNase

    • Bacterial RNA isolation following established protocols for transcriptome analysis

    These models allow for the study of HtpX expression and function during different stages of Brucella intracellular lifecycle.

  • How does growth phase affect htpX expression in Brucella?

    Growth phase significantly impacts gene expression in Brucella species, and htpX expression likely varies between logarithmic and stationary phases. Based on studies of other Brucella genes:

    • Late-log phase cultures often show distinct transcriptional profiles compared to stationary phase cultures

    • Quantitative differences in gene expression can be determined using microarray analysis and validated by quantitative RT-PCR

    To study htpX expression across growth phases:

    • Culture Brucella suis in appropriate media (such as F12K supplemented with 10% heat-inactivated fetal bovine serum)

    • Collect samples at different growth phases (early-log, late-log, and stationary phases)

    • Extract RNA using optimized protocols for Brucella

    • Analyze htpX expression by qRT-PCR or microarray analysis

    • Use appropriate housekeeping genes (such as the translation initiation factor IF-1) as reference for normalization

    Understanding growth phase-dependent expression helps determine optimal conditions for studying HtpX function and for recombinant protein production.

Advanced Research Questions

  • What transcriptional regulatory systems control htpX expression in Brucella suis?

    While specific data on htpX regulation in Brucella suis is limited, insights can be drawn from other regulatory systems in Brucella:

    The BvrR/BvrS two-component regulatory system likely influences htpX expression, as it regulates numerous genes involved in membrane integrity and stress response. This system:

    • Controls the expression of outer membrane proteins like Omp3a and Omp3b

    • Regulates lipid A acylation and surface molecule assembly

    • Affects expression of genes involved in metabolism and membrane transport

    To experimentally investigate htpX regulation:

    • Create reporter constructs using the htpX promoter region fused to reporter genes

    • Test expression in wild-type and regulatory mutant backgrounds (e.g., bvrR/bvrS mutants)

    • Perform chromatin immunoprecipitation to identify transcription factors binding to the htpX promoter

    • Use microarray or RNA-Seq to compare htpX expression between wild-type and regulatory mutants under various conditions

    • Follow microarray experimental design according to MIAME recommendations with appropriate replicates

    Understanding transcriptional regulation helps identify conditions that modify HtpX levels and potential interaction with other virulence systems.

  • How does HtpX contribute to Brucella pathogenesis during intracellular infection?

    HtpX likely plays a significant role during Brucella intracellular infection by:

    • Maintaining membrane protein quality during adaptation to the intracellular environment

    • Degrading damaged proteins that accumulate during oxidative stress encountered within host cells

    • Contributing to bacterial survival within the specialized replicative niche

    To investigate this experimentally:

    • Create htpX deletion mutants and complemented strains

    • Assess invasion ability in non-professional phagocytic cells like HeLa cells

    • Monitor intracellular replication kinetics, comparing wild-type and mutant strains

    • Perform comparative transcriptome analysis between wild-type and htpX mutants during intracellular infection

    • Isolate intracellular bacteria using cell lysis with 1% Triton followed by enzymatic digestion of host nucleic acids

    • Extract bacterial RNA for gene expression analysis using validated methods for intracellular Brucella

    These approaches would reveal whether HtpX is required for establishing or maintaining the replicative niche within host cells.

  • What biochemical approaches can identify HtpX substrates in Brucella suis?

    Identifying HtpX substrates requires multiple complementary approaches:

    In vitro approaches:

    • Express and purify recombinant HtpX with intact catalytic activity

    • Perform in vitro digestion assays with candidate substrates

    • Use mass spectrometry to identify cleavage sites

    In vivo approaches:

    • Compare membrane proteomes between wild-type and htpX mutant strains using 2D-PAGE or LC-MS/MS

    • Employ SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to quantify protein abundance differences

    • Use proximity labeling approaches with HtpX fused to promiscuous biotin ligases

    Computational approaches:

    • Perform in silico analysis to identify proteins with predicted HtpX recognition motifs

    • Analyze gene expression data to identify co-regulated genes that might encode substrates

    Given the membrane-associated nature of HtpX, special attention should be paid to extraction methods for membrane proteins, similar to approaches used for studying Brucella outer membrane proteins regulated by BvrR/BvrS .

  • How does HtpX function relate to stress response pathways in Brucella suis?

    HtpX likely integrates with broader stress response networks in Brucella:

    • It may coordinate with other proteases in envelope stress response pathways

    • Expression might be co-regulated with other stress response genes

    • Function may overlap with other quality control systems

    To investigate these relationships experimentally:

    • Examine htpX expression under various stress conditions (heat shock, oxidative stress, pH stress)

    • Create double mutants lacking htpX and other stress response genes

    • Perform global gene expression analysis using microarrays or RNA-Seq to identify co-regulated genes

    • Use statistical approaches like those described for Brucella microarray analysis, including normalization by quantiles and statistical analysis with t-test with FDR control (p<0.01)

    Understanding these relationships would provide insights into how Brucella adapts to hostile environments encountered during infection.

Methodological Questions

  • What are optimal protocols for expressing recombinant Brucella suis HtpX?

    Expressing functional recombinant HtpX presents challenges due to its membrane-embedded nature. Consider these methodological approaches:

    Expression systems:

    • E. coli BL21(DE3) with specialized vectors containing fusion tags (His, MBP, SUMO) to enhance solubility

    • Cell-free expression systems for membrane proteins

    • Expression in Brucella itself under control of inducible promoters

    Expression optimization:

    ParameterOptions to testNotes
    Temperature16°C, 25°C, 37°CLower temperatures reduce aggregation
    Induction0.1-1.0 mM IPTG or auto-inductionOptimize for yield vs. solubility
    MediaLB, TB, autoinduction mediaDifferent media affect protein folding
    AdditivesGlycerol, sucrose, detergentsMay stabilize membrane proteins
    Fusion partnersHis, MBP, SUMO, TrxEnhance solubility and purification

    Purification considerations:

    • Use mild detergents (DDM, LDAO) for membrane protein extraction

    • Consider purifying from inclusion bodies with refolding if necessary

    • Validate protein folding and activity after purification

    Confirm expression using western blot and verify activity using established enzymatic assays for metalloproteases.

  • How can enzymatic activity of recombinant HtpX be reliably measured?

    Assessing HtpX enzymatic activity requires appropriate substrates and conditions:

    Synthetic peptide substrates:

    • Design fluorogenic peptides based on predicted cleavage sites

    • Measure fluorescence increase upon cleavage

    • Include controls with known metalloprotease inhibitors (EDTA, phenanthroline)

    Activity assay conditions optimization:

    ParameterRange to testRationale
    pH6.0-8.5Determine pH optimum
    Temperature25-42°CAssess thermostability
    Divalent cationsZn²⁺, Mg²⁺, Ca²⁺Identify cofactor requirements
    DetergentsDDM, LDAO, Triton X-100Maintain protein solubility
    NaCl concentration50-500 mMEvaluate ionic strength effects

    Validation approaches:

    • Use site-directed mutagenesis to create catalytically inactive variants (e.g., mutation in the zinc-binding motif)

    • Compare wild-type and mutant activity

    • Test activity against candidate physiological substrates

    These methodological approaches provide a foundation for characterizing HtpX enzymatic properties and substrate specificity.

  • What approaches can identify the role of HtpX in Brucella pathogenesis?

    Multiple complementary approaches can elucidate HtpX's role in pathogenesis:

    Genetic approaches:

    • Generate clean deletion mutants of htpX

    • Create point mutations in catalytic residues

    • Develop complemented strains expressing wild-type or mutant htpX

    Cellular infection models:

    • Assess invasion ability in HeLa cells using protocols similar to those used for other Brucella studies

    • Monitor intracellular replication kinetics in professional and non-professional phagocytes

    • Examine intracellular trafficking using fluorescence microscopy

    • Quantify bacterial survival rates following methodology described for Brucella infection studies

    Transcriptomic/proteomic approaches:

    • Compare gene expression profiles between wild-type and htpX mutant strains during infection

    • Use RNA isolation methods established for intracellular Brucella

    • Apply microarray techniques with appropriate statistical analysis

    • Validate findings with qRT-PCR using primers designed with Primer Express software and normalized to housekeeping genes like IF-1

    These approaches collectively would establish whether and how HtpX contributes to Brucella pathogenesis.

  • How can transcriptome analysis be optimized for studying htpX-related pathways in Brucella?

    Transcriptome analysis requires careful experimental design and execution:

    RNA isolation optimization:

    • For free-living bacteria: collect at appropriate growth phases (late-log vs. stationary)

    • For intracellular bacteria: lyse host cells with 1% Triton, remove host nucleic acids with DNase/RNase treatment

    • Ensure high-quality RNA (RIN > 8.0) for reliable results

    Microarray considerations:

    • Follow MIAME recommendations for experimental design

    • Include biological triplicates for statistical robustness

    • Use appropriate controls (constitutively expressed genes like translation initiation factor IF-1)

    • Print each gene in duplicate on slides to increase measurement reliability

    Data analysis approach:

    • Normalize data appropriately (e.g., quantiles normalization)

    • Apply statistical analysis with t-test and FDR control (p<0.01)

    • Validate key findings using qRT-PCR

    • Use hierarchical clustering and principal component analysis for data visualization

    Comparative analysis:

    • Compare wild-type vs. htpX mutant under various conditions

    • Analyze expression patterns during different growth phases and stress conditions

    • Categorize differentially expressed genes into functional categories using COGs (Clusters of Orthologous Groups)

    This comprehensive approach allows for robust identification of genes co-regulated with htpX or affected by htpX mutation.

Advanced Experimental Considerations

  • What structural biology approaches can elucidate HtpX function in Brucella?

    Structural analysis of HtpX presents challenges due to its membrane-embedded nature but offers valuable insights:

    Structural determination approaches:

    • X-ray crystallography of soluble domains or full-length protein in detergent micelles

    • Cryo-electron microscopy for membrane-embedded structures

    • NMR spectroscopy for dynamic regions and substrate interactions

    Computational approaches:

    • Homology modeling based on related bacterial proteases

    • Molecular dynamics simulations to understand substrate binding and catalysis

    • Protein-protein interaction modeling for substrate recognition

    Structural information would reveal the catalytic mechanism, substrate binding pockets, and potential for targeted inhibition, providing fundamental insights into HtpX function in Brucella suis.

  • How can systems biology approaches integrate HtpX function into broader Brucella pathogenesis networks?

    Systems biology offers a holistic view of HtpX's role within Brucella's adaptive networks:

    Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and htpX mutants

    • Identify gene regulatory networks using algorithms like WGCNA (Weighted Gene Co-expression Network Analysis)

    • Map protein-protein interaction networks involving HtpX

    Data integration approaches:

    • Use principal component analysis (PCA) to identify major sources of variation in multi-omics data

    • Apply hierarchical clustering to identify co-regulated genes

    • Construct pathway models incorporating HtpX function

    Validation experiments:

    • Test predicted network interactions through targeted experiments

    • Examine epistasis between htpX and other key regulators like bvrR/bvrS

    These approaches would position HtpX within the broader context of Brucella adaptation and pathogenesis mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.