Recombinant Brugia malayi Protein JTB (JTB)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant JTB is produced via heterologous expression in E. coli or yeast systems, with E. coli being more cost-effective for large-scale production .

HostTagPurityApplicationSource
E. coliN-terminal 6xHis-SUMO>90% SDS-PAGEELISA, WB
YeastHis tag>90% SDS-PAGEELISA, WB

Functional Domains

  • Extracellular Domain (AA 31-105): Contains cysteine-rich motifs critical for protein interactions and mitochondrial targeting .

  • N-terminal Tags: Enhance solubility and facilitate purification via affinity chromatography (e.g., nickel columns for His-tagged proteins) .

Cellular Roles

JTB is implicated in mitotic regulation as a potential component of the Chromosomal Passenger Complex (CPC), which ensures proper chromosome segregation during mitosis . In Brugia malayi, it may influence cell proliferation and survival under oxidative stress .

FunctionMechanismReference
Mitochondrial DynamicsInduces mitochondrial clustering near nuclei and reduces membrane potential
Cytokinesis RegulationRequired for normal cell division, possibly via CPC complex integration
Oxidative Stress ResponseMay protect cells from oxidative damage via cysteine-dependent mechanisms

Research Applications

  • Cancer Studies: Human JTB homologs are overexpressed in breast and prostate cancers, linking it to epithelial-mesenchymal transition (EMT) and metastasis .

  • Parasitology: Investigated for its role in filarial parasite survival and potential as a vaccine target .

Comparative Analysis with Human JTB

FeatureBrugia malayi JTBHuman JTB
Expression DomainAA 31-105 (extracellular) Full-length (146 AA)
Primary FunctionMitochondrial dynamics, oxidative stressChromosome alignment, EMT in cancer
Research FocusParasite survival, vaccine developmentCancer biomarker, therapeutic target
Purification TagsHis-SUMO or His GST, Fc, or untagged

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
JTB; Protein JTB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-146
Protein Length
full length protein
Species
Brugia malayi (Filarial nematode worm)
Target Names
JTB
Target Protein Sequence
EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHLFWKFEGTVVAVALVFACLVIIRQRQLDRKALEKVRKQIESI
Uniprot No.

Target Background

Function
JTB protein is essential for normal cytokinesis during mitosis. It plays a crucial role in regulating cell proliferation. It may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has critical functions at the centromere in ensuring accurate chromosome alignment and segregation. Additionally, it is required for chromatin-induced microtubule stabilization and spindle assembly.
Protein Families
JTB family
Subcellular Location
Membrane; Single-pass type I membrane protein. Mitochondrion. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle.

Q&A

What is Brugia malayi Protein JTB and what are its known biological functions?

Brugia malayi Protein JTB is a protein expressed by the filarial nematode worm Brugia malayi, a parasitic organism that causes lymphatic filariasis in humans. Based on functional characterization, JTB is required for normal cytokinesis during mitosis and plays a critical role in the regulation of cell proliferation. Current evidence suggests it may function as a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis . The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly . As a membrane protein with both intracellular and extracellular domains, it likely participates in cellular signaling pathways that regulate growth and division in the parasite.

How is recombinant B. malayi JTB protein typically expressed and purified for research applications?

Recombinant B. malayi JTB protein is most commonly expressed in prokaryotic systems, with E. coli being the predominant expression host . The protein is typically expressed with an N-terminal 6xHis-SUMO tag to enhance solubility and facilitate purification . Expression protocols generally include the following steps:

  • Transformation of expression plasmid into E. coli strains optimized for recombinant protein production

  • Culture growth at 37°C until reaching optimal density

  • Induction with IPTG at reduced temperatures (16-22°C) to enhance proper folding

  • Cell harvest and lysis using methods that preserve protein integrity

  • Purification via affinity chromatography utilizing the His-tag

  • Optional secondary purification steps such as size exclusion chromatography

  • Quality control assessment by SDS-PAGE to confirm >90% purity

Alternative expression systems including yeast have also been successfully employed for B. malayi JTB production, though E. coli remains the most cost-effective and widely used platform .

How can recombinant B. malayi JTB be used to study host-parasite interactions in lymphatic filariasis?

Recombinant B. malayi JTB serves as a valuable tool for investigating key aspects of host-parasite interactions in lymphatic filariasis research through several approaches:

  • Immune Response Studies: Purified JTB can be used to assess host immune recognition and response patterns, potentially identifying epitopes recognized by protective immune responses.

  • Cellular Interaction Assays: The protein can be employed in binding studies with host cells to identify potential receptors or interaction partners on human immune or lymphatic endothelial cells.

  • Comparative Analysis: Structural and functional comparisons between B. malayi JTB and human JTB (Jumping Translocation Breakpoint) can reveal unique features that might be exploited for selective targeting.

  • Antibody Development: Researchers can generate specific antibodies against B. malayi JTB for immunolocalization studies, tracking the protein's expression and distribution throughout different parasite life stages during infection.

  • Drug Target Validation: In vitro screening assays incorporating recombinant JTB can identify compounds that specifically interact with the parasite protein without affecting the human homolog.

These applications contribute to our understanding of the molecular mechanisms underlying B. malayi infection and may lead to novel diagnostic or therapeutic approaches for lymphatic filariasis.

What experimental approaches are recommended for studying potential roles of JTB in B. malayi's response to antibiotic treatment?

Research into B. malayi's response to antibiotic treatments that target Wolbachia endosymbionts provides insights into potential roles of JTB and similar proteins. Recommended experimental approaches include:

  • Gene Expression Analysis: Quantitative RT-PCR to measure JTB transcript levels before and after antibiotic treatment, potentially revealing bimodal expression patterns similar to other signaling molecules observed in B. malayi response to tetracycline .

  • Protein Localization Studies: Immunofluorescence microscopy using anti-JTB antibodies to track changes in protein distribution following antibiotic treatment, with particular attention to embryonic tissues and hypodermis where differential responses have been observed .

  • Temporal Analysis: Time-course experiments examining JTB expression at multiple timepoints (1-6 days post-treatment) to capture early and late responses to antibiotic treatment .

  • Tissue-Specific Assessment: Comparison of JTB regulation in male versus female worms to distinguish between embryogenesis-related and hypodermal responses, as male worms lacking developing embryos show different response patterns to antibiotics .

  • Co-expression Network Analysis: Correlation of JTB expression with other genes known to respond to Wolbachia depletion, particularly those involved in protein translation, amino acid synthesis, and cuticle biosynthesis pathways .

These approaches can help elucidate whether JTB plays a role in the parasite's adaptation to stress conditions induced by antibiotic treatment targeting its essential endosymbionts.

What are the optimal storage and handling conditions for maintaining recombinant B. malayi JTB stability?

Proper storage and handling of recombinant B. malayi JTB is critical for maintaining structural integrity and functional activity:

For Lyophilized Protein:

  • Store at -20°C or preferably -80°C

  • Stable for up to 12 months when properly stored

  • Protect from moisture and maintain in sealed containers

For Reconstituted Protein:

  • Store working aliquots at 4°C for up to one week

  • For longer storage, prepare small single-use aliquots and store at -80°C

  • Avoid repeated freeze-thaw cycles (limit to 2-3 maximum)

  • Typical reconstitution buffer: 10 mM HEPES, 500 mM NaCl, pH 7.4 with 5% trehalose

Reconstitution Protocol:

  • Centrifuge the vial at 10,000 rpm for 1 minute before opening

  • Reconstitute at 200 μg/mL in sterile distilled water by gentle pipetting (2-3 times)

  • Avoid vortexing which can cause protein denaturation

Stabilizing Additives:

  • Addition of 5% trehalose or 10% glycerol can enhance stability

  • For dilute solutions, consider adding 0.1-1% BSA as a carrier protein

Following these guidelines helps maintain the functional integrity of recombinant B. malayi JTB throughout experimental workflows.

What quality control measures should be implemented when working with recombinant B. malayi JTB?

Rigorous quality control is essential when working with recombinant B. malayi JTB to ensure experimental reproducibility:

Purity Assessment:

  • SDS-PAGE analysis should confirm >90-95% purity

  • Mass spectrometry to verify protein identity and integrity

  • Endotoxin testing is particularly important for immunological studies

Structural Integrity Evaluation:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Dynamic light scattering to check for aggregation

  • Native PAGE to evaluate oligomeric state

Functional Validation:

  • Western blotting with anti-JTB antibodies

  • Binding assays with known interaction partners

  • Activity assays relevant to hypothesized JTB function

Batch Consistency Measures:

  • Standardized expression and purification protocols

  • Reference standards for comparison between batches

  • Detailed record-keeping of all production parameters

Quality ParameterAcceptance CriteriaRecommended Method
Purity>90%SDS-PAGE with densitometry
IdentityMatches expected sequenceMass spectrometry
Aggregation<10% high molecular weight speciesSize exclusion chromatography
Endotoxin<1.0 EU/mg proteinLAL assay
FoldingConsistent with reference standardCircular dichroism

Implementation of these quality control measures ensures that experimental outcomes are attributable to the biological properties of B. malayi JTB rather than preparation artifacts.

How can researchers address solubility and stability challenges when working with recombinant B. malayi JTB?

Solubility and stability challenges are common when working with recombinant proteins. For B. malayi JTB, several strategies can be employed:

Expression Optimization:

  • Lower induction temperature (16-20°C instead of 37°C)

  • Reduce IPTG concentration (0.1-0.5 mM)

  • Use specialized E. coli strains designed for recombinant protein expression

  • Consider co-expression with chaperones to improve folding

Solubility Enhancement:

  • Test different buffer compositions with varying pH (7.0-8.0) and salt concentrations (150-500 mM NaCl)

  • Add solubility enhancers:

    • 5-10% glycerol or 5% trehalose to stabilize protein structure

    • 0.01-0.05% non-ionic detergents for membrane-associated regions

    • 0.5-1 M arginine for particularly challenging constructs

Tag Selection:

  • The N-terminal 6xHis-SUMO tag has proven effective for B. malayi JTB expression

  • Alternative tags like MBP (maltose-binding protein) can provide additional solubility benefits

  • Consider tag removal strategies if the tag interferes with functional studies

Buffer Optimization for Different Applications:

  • For ELISA: PBS (pH 7.4) with 0.05% Tween-20

  • For storage: 10 mM HEPES, 500 mM NaCl, 5% trehalose, pH 7.4

  • For binding assays: 20 mM HEPES, 150 mM NaCl, pH 7.4

Systematic testing of these approaches can significantly improve the yield and quality of functional recombinant B. malayi JTB for research applications.

What are the recommended protocols for using B. malayi JTB in immunological detection methods?

Western Blot Protocol:

  • Sample Preparation:

    • Mix recombinant JTB (0.1-1 μg) with Laemmli buffer

    • Heat at 95°C for 5 minutes

    • For native parasite extracts, use RIPA buffer supplemented with protease inhibitors

  • Electrophoresis:

    • Run on 12-15% SDS-PAGE (optimal for ~24.4 kDa protein)

    • Include appropriate molecular weight markers

    • Run at 100-120V until dye front reaches bottom of gel

  • Transfer:

    • Transfer to PVDF membrane (0.45 μm) at 100V for 1 hour or 30V overnight

    • Verify transfer efficiency with reversible protein stain

  • Immunodetection:

    • Block with 5% non-fat milk or 3% BSA in TBS-T for 1 hour at room temperature

    • Incubate with primary anti-JTB antibody (typically 1:1000 to 1:5000 dilution)

    • Wash 4-5 times with TBS-T

    • Incubate with HRP-conjugated secondary antibody (1:5000-1:10000)

    • Develop using ECL substrate and appropriate detection method

ELISA Protocol:

  • Coating:

    • Dilute recombinant JTB to 1-5 μg/mL in carbonate buffer (pH 9.6)

    • Add 100 μL per well to high-binding ELISA plates

    • Incubate overnight at 4°C

  • Blocking and Detection:

    • Wash 3 times with PBS-T (PBS + 0.05% Tween-20)

    • Block with 3% BSA in PBS-T for 1-2 hours

    • Add samples/antibodies diluted in 1% BSA/PBS-T

    • After incubation and washing, add detection antibody

    • Develop with appropriate substrate and measure absorbance

Immunofluorescence Microscopy:

  • Sample Preparation:

    • Fix parasite specimens in 4% paraformaldehyde

    • Permeabilize with 0.1-0.5% Triton X-100 if targeting intracellular epitopes

    • Block with 5% normal serum from secondary antibody host species

  • Antibody Incubation:

    • Apply primary anti-JTB antibody (1:100-1:500) overnight at 4°C

    • Wash thoroughly with PBS

    • Apply fluorophore-conjugated secondary antibody (1:500)

    • Include DAPI for nuclear counterstaining

These protocols can be optimized based on specific experimental requirements and antibody characteristics.

How does B. malayi JTB compare structurally and functionally to human JTB protein?

Understanding the structural and functional similarities and differences between B. malayi JTB and human JTB provides valuable insights for targeted research approaches:

Structural Comparison:

FeatureB. malayi JTBHuman JTB
Alternative NamesProtein JTBHJT, HJTB, HSPC222, PAR protein
Cellular LocalizationMembrane protein with extracellular domainMembrane protein associated with jumping translocations
Size of Recombinant Protein24.4 kDa (with tags) Varies by construct
Expression RegionExtracellular domain (AA 31-105) Various domains depending on research focus
Sequence HomologyReference sequenceLimited homology to B. malayi JTB

Functional Comparison:

  • B. malayi JTB is required for normal cytokinesis during mitosis and regulates cell proliferation

  • Human JTB is associated with jumping translocation breakpoints and may have roles in oncogenesis

  • Both proteins appear to be involved in cell division processes, though through potentially different mechanisms

  • The B. malayi protein may be a component of the chromosomal passenger complex, while human JTB functions in other cellular contexts

These differences present opportunities for selective targeting in therapeutic development, as compounds that interact with parasite-specific structural features might not affect the human homolog.

What insights can B. malayi JTB provide into the relationship between the parasite and its Wolbachia endosymbiont?

B. malayi, like most human filarial parasite species, harbors an endosymbiotic bacterium of the genus Wolbachia that is essential for parasite survival and reproduction . Although direct evidence linking JTB to Wolbachia interactions is limited, several research avenues suggest potential connections:

  • Gene Expression Patterns: Antibiotic treatment targeting Wolbachia induces complex changes in B. malayi gene expression, particularly in proteins involved in translation, amino acid synthesis, and cuticle biosynthesis . JTB may be regulated as part of these stress-response pathways.

  • Temporal Response Profiles: Many signaling proteins in B. malayi show a bimodal pattern of expression following antibiotic treatment, with peaks at early (1 day) and later (6 day) timepoints . This pattern potentially reflects different tissue-specific responses to Wolbachia depletion.

  • Tissue-Specific Effects: The differential impact of Wolbachia elimination on embryogenic tissues versus adult hypodermis suggests tissue-specific roles for proteins like JTB in maintaining the symbiotic relationship .

  • Cell Division Regulation: Since JTB functions in cytokinesis and cell proliferation , and Wolbachia elimination leads to sterilization of adult female worms , JTB may be part of the molecular framework linking endosymbiont health to parasite reproduction.

Studying JTB expression and function in the context of the B. malayi-Wolbachia relationship could reveal important aspects of this essential symbiosis and potentially identify new therapeutic approaches.

What methodological approaches are recommended for identifying potential binding partners of B. malayi JTB?

Several complementary experimental approaches can be employed to identify and characterize potential binding partners of B. malayi JTB:

Affinity-Based Methods:

  • Pull-Down Assays: Using His-tagged recombinant JTB as bait to isolate interacting proteins from parasite lysates

  • Co-Immunoprecipitation: Employing anti-JTB antibodies to precipitate protein complexes from native parasite tissues

  • Cross-Linking Mass Spectrometry: Chemical cross-linking followed by proteomic analysis to identify interaction interfaces

Library Screening Approaches:

  • Yeast Two-Hybrid: Screening a B. malayi cDNA library for potential interacting partners

  • Phage Display: Identifying peptides that bind specifically to recombinant JTB

  • Protein Arrays: Testing recombinant JTB against arrays of B. malayi proteins

Biophysical Interaction Analysis:

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics and affinity

  • Isothermal Titration Calorimetry (ITC): Determination of thermodynamic parameters of binding

  • Microscale Thermophoresis (MST): Solution-based measurement of molecular interactions

Validation Strategies:

  • Co-localization Studies: Immunofluorescence microscopy to confirm spatial proximity in parasite tissues

  • Functional Assays: Assessments of how potential interactions affect JTB's role in cell division

  • Mutational Analysis: Creating targeted mutations in predicted binding interfaces to disrupt interactions

To enhance specificity and reduce false positives, researchers should implement stringent controls, including:

  • Tag-only controls to identify tag-mediated interactions

  • Irrelevant proteins of similar size/structure

  • Competition experiments with unlabeled protein

  • Concentration-dependent binding assessments

These methodological approaches, when used in combination, provide a robust framework for identifying and characterizing the interactome of B. malayi JTB.

What are the most promising research directions for B. malayi JTB as a potential therapeutic target?

Based on current understanding of B. malayi JTB structure and function, several promising research directions emerge for exploring its potential as a therapeutic target:

  • Structure-Based Drug Design: Determining the three-dimensional structure of B. malayi JTB would enable rational design of small molecules that selectively bind to parasite-specific structural features not present in human JTB.

  • Functional Inhibition Studies: Developing assays to measure JTB's role in cell division and using these to screen for compounds that disrupt this function could identify lead molecules for anti-filarial drug development.

  • Antibody-Based Therapeutics: The extracellular domain of JTB may be accessible to antibody-based therapeutics that could interfere with its function or trigger immune-mediated clearance of parasites.

  • Role in Wolbachia Symbiosis: Further investigation of JTB's potential involvement in maintaining the critical relationship between B. malayi and its Wolbachia endosymbiont could reveal indirect targeting strategies.

  • Vaccine Development: Assessing whether recombinant JTB can elicit protective immunity in animal models would evaluate its potential as a vaccine candidate.

These research avenues leverage our growing understanding of B. malayi JTB biology while addressing the continuing need for new approaches to combat lymphatic filariasis, a neglected tropical disease affecting millions worldwide.

What experimental systems are most appropriate for studying B. malayi JTB function in vivo?

Studying B. malayi JTB function in vivo presents significant challenges due to the complex life cycle and host requirements of filarial nematodes. Several experimental systems offer complementary advantages:

Animal Models:

  • Jirds (Meriones unguiculatus): Can support patent B. malayi infections and allow recovery of adult worms for analysis

  • SCID mice: Immunocompromised models permit limited B. malayi development

  • Laboratory mosquitoes: Enable study of larval development stages

In Vitro Culture Systems:

  • Adult worm culture: Maintains viable adult B. malayi for 1-6 days, allowing treatment and gene expression studies

  • Microfilariae culture: Permits study of early developmental stages

  • Embryogram assays: Enables assessment of embryogenesis in isolated females

Molecular Approaches:

  • RNAi: Though challenging in parasitic nematodes, some success has been reported for gene knockdown

  • Transgenesis: Emerging techniques for genetic modification of filarial worms

  • Ex vivo drug testing: Evaluation of compounds targeting JTB in cultured parasites

Surrogate Systems:

  • Caenorhabditis elegans: Free-living nematode model for studying homologous genes

  • Cell-based assays: Recombinant expression of B. malayi JTB in mammalian cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.