Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; BU273; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
clsA
Target Protein Sequence
MDIFYNLIKCLIFSTYWLLIANITFRVLIKRRNIPYSMSWLLTIYIIPFIGISIWFFFGE LYLGKRQKKIANRIWSISNKWLHELKSCTYIFQIKNSEVATSIFQLCKNRQGLHGIKSKK IKLLTNTKKIMQILIRDIYLARKNIEMVFYIWKPGGMADDVAIALIDSAKRGIHCRLMLD SAGSIEFFQSPWVEIMRKSGIQVVEALKVNLLRVFLRRVDVRQHRKIILIDNYIAYSGSM NLVDPYLFKKSSEIGQWIDLMTRIEGPIATTMGIIYSCDWEIETGLKILPQLPNKKMLEN QSNKNASIQVIASGPGFLKNMIHQALLTAIYSAKRELIITTPYLVPSEDLLEAICTAAQR GVEVSIIIPLYNDSILVKWASRVFFSELLEAGVKIFQFQKGLLHSKSILVDQQLSLIGTV NLDMRSLWLNFEITLVIDDSDFGRNLFCIQNKYISDSQLIDKKAWSMRAYWKRILEKIFY FLSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links

KEGG: buc:BU273

STRING: 107806.BU273

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what is its significance in symbiotic relationships?

Buchnera aphidicola is an obligate bacterial endosymbiont found in aphids, with the symbiotic relationship dating back approximately 100 to 200 million years. This symbiotic association is essential for aphid survival as Buchnera supplies essential amino acids to compensate for the protein-deficient plant sap diet of its insect host . The symbiont is vertically transmitted to the next generation through ovarial passage, ensuring continuity of the relationship .

Despite significant genome reduction, Buchnera has retained the capability of synthesizing most essential amino acids while losing most genes for synthesizing non-essential amino acids. This genomic specialization reflects its critical role in nutritional supplementation to the aphid host . Understanding this relationship provides insights into co-evolutionary processes and specialized metabolic complementation between hosts and symbionts.

What is the role of Cardiolipin synthase (cls) in Buchnera aphidicola?

Cardiolipin synthase (cls) in Buchnera aphidicola is an enzyme responsible for the synthesis of cardiolipin, a critical phospholipid component of bacterial membranes. Cardiolipin is particularly important for membrane integrity and function. Based on studies of cardiolipin synthase in other bacterial systems, this enzyme is typically tightly associated with the membrane and co-purifies with its substrate, phosphatidylglycerol (PG), and its product, cardiolipin (CL) .

The gene encoding cardiolipin synthase in Buchnera aphidicola from Acyrthosiphon pisum is often abbreviated as cls or clsA . This enzyme plays an essential role in phospholipid metabolism and membrane composition, which is crucial for cellular functions in this obligate endosymbiont with its highly reduced genome.

How does the genetic structure of Cardiolipin synthase differ between various Buchnera strains, and what are the evolutionary implications?

The complete sequence of Cardiolipin synthase from Buchnera aphidicola subsp. Acyrthosiphon pisum consists of 486 amino acids with a characteristic transmembrane domain structure . When compared with other Buchnera strains, such as those from C. tujafilina (BCt) and C. cedri (BCc), subtle differences in the gene may exist that reflect the different metabolic requirements of their respective hosts.

The evolutionary trajectory of Cardiolipin synthase in Buchnera must be understood in the context of massive gene loss during genome reduction. Analysis of the gene repertoire of the last common ancestor of various Buchnera strains indicates that while stochastic gene loss plays a role in genome reduction, functional constraints related to metabolism are also powerful evolutionary forces . The retention of cls throughout this reduction process highlights its essential role in Buchnera physiology.

What is the relationship between Cardiolipin synthase activity and the biotype differentiation observed in aphid hosts?

Recent research suggests a potential relationship between Buchnera metabolism and aphid biotype differentiation. Studies on Sitobion avenae (grain aphid) have shown that Buchnera abundance varies among different biotypes when fed on different wheat and barley varieties . Reduction of Buchnera abundance through antibiotic treatment altered the virulence of aphid biotypes, suggesting that Buchnera-mediated metabolism influences host adaptability.

Since membrane composition and integrity (influenced by Cardiolipin synthase) are fundamental to cellular function, including metabolite transport and protein synthesis, it is plausible that variations in cls activity could indirectly affect amino acid provisioning to the host, thereby potentially contributing to biotype differentiation. This represents an area for future investigation to establish direct links between cls function and host adaptation.

What are the optimal conditions for expressing and purifying recombinant Buchnera aphidicola Cardiolipin synthase?

Based on commercial recombinant protein protocols and research methodologies, the following approach is recommended for expressing and purifying recombinant Buchnera aphidicola Cardiolipin synthase:

Expression System:

  • E. coli is the preferred host for expression of recombinant Cls from Buchnera aphidicola .

  • The full-length protein (486 amino acids) should be expressed with an N-terminal His-tag to facilitate purification .

Purification Protocol:

  • Express the protein in E. coli using standard induction protocols.

  • Harvest cells and lyse using appropriate buffer systems.

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins).

  • Aim for >90% purity as determined by SDS-PAGE .

Storage Recommendations:

  • Store the purified protein at -20°C/-80°C upon receipt.

  • For working stocks, aliquot and store at 4°C for up to one week.

  • Avoid repeated freeze-thaw cycles as this can reduce enzymatic activity .

Reconstitution:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol (5-50% final concentration) for long-term storage at -20°C/-80°C .

These conditions have been optimized based on protocols for similar membrane-associated enzymes and should provide a functional recombinant Cardiolipin synthase suitable for biochemical and structural studies.

How can researchers effectively design experiments to investigate the functional relationship between Buchnera Cardiolipin synthase and aphid host adaptation?

To investigate the functional relationship between Buchnera Cardiolipin synthase and aphid host adaptation, researchers should consider a multi-faceted experimental approach:

1. Antibiotic Manipulation Studies:

  • Treat aphids with rifampicin at carefully calibrated concentrations (e.g., 2 μg/mL for 24h) to reduce but not eliminate Buchnera abundance .

  • Compare aphid performance on resistant and susceptible plant varieties before and after treatment.

  • Monitor development duration, fecundity, and survival rates as indicators of host adaptation.

2. Transcriptomic Analysis:

  • Perform RNA-seq on different aphid biotypes to identify differential expression of Buchnera genes.

  • Focus on cls expression patterns in relation to other metabolic genes, particularly those involved in amino acid synthesis.

  • Use principal component analysis to identify key patterns and correlations with phenotypic traits .

3. Site-Directed Mutagenesis:

  • Create recombinant Cls variants with specific amino acid substitutions based on natural variations observed in different Buchnera strains.

  • Characterize enzymatic activity of these variants using biochemical assays.

  • Reference studies of cls mutations in other bacterial systems for methodological guidance .

4. Artificial Diet Experiments:

  • Develop artificial diets with controlled amino acid compositions to test hypotheses about nutritional supplementation.

  • Compare performance of aphids harboring Buchnera with different cls variants on these diets.

  • Focus particularly on essential amino acids like leucine and tryptophan, which have been implicated in biotype differentiation .

5. Membrane Composition Analysis:

  • Analyze phospholipid profiles, particularly cardiolipin content, in Buchnera from different aphid biotypes.

  • Correlate membrane composition with cls sequence variations and enzymatic activity.

  • Investigate potential impacts on membrane integrity and transport functions.

This comprehensive approach would provide insights into both the direct biochemical role of Cardiolipin synthase and its broader ecological significance in the aphid-Buchnera symbiosis.

How should researchers interpret comparative genomic data when analyzing Cardiolipin synthase conservation across Buchnera strains?

When interpreting comparative genomic data for Cardiolipin synthase across Buchnera strains, researchers should consider multiple analytical dimensions:

1. Sequence Conservation vs. Functional Divergence:

  • Evaluate both amino acid sequence identity and similarity scores.

  • Pay particular attention to conservation in catalytic domains versus potential variability in regulatory regions.

  • Consider that even minor sequence variations might have significant functional implications in a highly reduced genome like Buchnera's.

2. Contextual Genomic Environment:

  • Analyze the genomic neighborhood of cls across different Buchnera strains.

  • Note that Buchnera genomes show "nearly perfect gene order conservation" , so any variations in cls positioning may be functionally significant.

  • Consider the implications of genome size variations across strains, as shown in this comparative table:

Genomic propertyBApBSgBBpBCcBCt
Genome size (bp)652,115653,001618,379425,229452,999
Chromosome size (bp)640,681642,454615,980416,380444,930
Total no. of genes609597546402404
G+C content (%)26.2426.3025.3020.2025.00

3. Evolutionary Rate Analysis:

  • Compare the evolutionary rate of cls with other Buchnera genes to determine if it's under stronger selective pressure.

  • Consider the time frame of Buchnera-aphid symbiosis (100-200 million years) when interpreting sequence divergence.

  • Evaluate whether cls shows evidence of purifying selection, suggesting functional constraint, or positive selection, indicating potential adaptive evolution.

4. Host-Symbiont Co-evolutionary Patterns:

  • Analyze whether cls variations correlate with aphid phylogeny or ecological niches.

  • Consider the influence of secondary symbionts (like "Ca. Serratia symbiotica") on Buchnera genome evolution and potential impacts on cls function .

5. Metabolic Network Context:

  • Interpret cls conservation in the context of broader metabolic capabilities retained in different Buchnera strains.

  • Consider how cls function relates to retained essential amino acid pathways versus lost non-essential amino acid pathways .

This multi-layered interpretation approach will provide a more comprehensive understanding of cls evolution and its significance in the Buchnera-aphid symbiosis.

What methodological challenges exist in measuring the enzymatic activity of recombinant Cardiolipin synthase, and how can researchers address potential artifacts?

Measuring the enzymatic activity of recombinant Cardiolipin synthase from Buchnera presents several methodological challenges that researchers must address to obtain reliable data:

1. Membrane Association Challenges:

  • Challenge: Cardiolipin synthase is tightly associated with membranes and co-purifies with its substrate phosphatidylglycerol (PG) and product cardiolipin (CL) .

  • Solution: Use detergent-based extraction methods optimized for membrane proteins, followed by reconstitution in liposomes or nanodiscs to provide a native-like membrane environment for activity assays.

2. Substrate Availability Issues:

  • Challenge: Ensuring consistent substrate presentation in an in vitro system.

  • Solution: Prepare defined phospholipid vesicles with controlled PG content. Consider that "the amount of PG that copurifies with Cls is in molar excess to protein, suggesting that the enzyme localizes to PG-rich membrane regions" .

3. Detection and Quantification Limitations:

  • Challenge: Accurate measurement of cardiolipin production.

  • Solution: Implement multiple complementary analytical techniques such as:

    • Thin-layer chromatography with phospholipid staining

    • Mass spectrometry for precise molecular species identification

    • Radioactive labeling of substrates for kinetic studies

4. Protein Stability Concerns:

  • Challenge: Maintaining enzyme stability during purification and assays.

  • Solution: Include glycerol (5-50%) in storage buffers , minimize freeze-thaw cycles, and optimize buffer conditions (pH, ionic strength) based on protein characteristics.

5. Validating Recombinant Protein Activity:

  • Challenge: Ensuring the recombinant protein faithfully represents native enzymatic properties.

  • Solution: Compare kinetic parameters with those of related enzymes from model organisms. Reference studies of enzymatic changes in cls mutations could provide useful benchmarks, such as the observed increases in Vmax from 0.16 ± 0.01 to 0.26 ± 0.02 μM CL/min/μM protein in certain bacterial cls variants .

6. Background Activity Interference:

  • Challenge: E. coli expression systems may contribute background phospholipid metabolism.

  • Solution: Include appropriate negative controls using expression hosts transformed with empty vectors. Alternatively, consider using E. coli strains with deletions in endogenous cls genes.

By addressing these methodological challenges systematically, researchers can obtain more reliable measurements of Cardiolipin synthase activity and better understand its role in Buchnera aphidicola biology.

What novel approaches could be used to investigate the role of Cardiolipin synthase in the context of the highly reduced Buchnera genome?

Several innovative approaches could advance our understanding of Cardiolipin synthase function within the highly reduced Buchnera genome:

1. CRISPR-Cas9-based Genome Editing in Model Systems:

  • Although direct genetic manipulation of Buchnera remains challenging due to its obligate intracellular lifestyle, researchers could create model systems by expressing Buchnera cls in E. coli with its native cls genes deleted.

  • This would allow for site-directed mutagenesis to study structure-function relationships and complement with various cls variants to identify critical residues.

2. Single-Cell Omics Approaches:

  • Apply single-cell transcriptomics and proteomics to bacteriocytes containing Buchnera to examine cls expression patterns in different host physiological states.

  • Correlate cls expression with changes in host diet, development stage, or environmental stressors.

3. Advanced Microscopy Techniques:

  • Employ super-resolution microscopy to visualize the localization of Cardiolipin synthase within Buchnera cells.

  • Use fluorescent lipid probes to track cardiolipin distribution in membranes and correlate with cellular functions.

4. Systems Biology Integration:

5. Host-Symbiont Interaction Studies:

  • Investigate potential signaling between aphid hosts and Buchnera that might regulate cls expression.

  • Examine whether host factors directly influence cardiolipin synthesis, possibly as a regulatory mechanism for symbiont function.

6. Evolutionary Synthetic Biology:

  • Reconstruct ancestral cls sequences based on comparative genomics to understand the evolutionary trajectory of this enzyme in Buchnera.

  • Express these reconstructed enzymes to characterize changes in catalytic properties over evolutionary time.

These approaches would provide deeper insights into how Cardiolipin synthase functions within the constraints of a highly reduced genome and contributes to the maintenance of this ancient symbiotic relationship.

How might research on Buchnera aphidicola Cardiolipin synthase inform broader understanding of membrane biology in obligate endosymbionts?

Research on Buchnera aphidicola Cardiolipin synthase has significant potential to advance our understanding of membrane biology in obligate endosymbionts through several key dimensions:

1. Metabolic Integration at Membrane Interfaces:

  • Cardiolipin-rich membrane domains may serve as organizing centers for metabolic enzymes involved in amino acid synthesis and exchange.

  • Understanding how cls activity influences membrane composition could reveal how Buchnera optimizes its limited metabolic capacity to meet host requirements.

2. Membrane Adaptation in Genome-Reduced Organisms:

  • Buchnera has undergone extreme genome reduction while maintaining essential functions. Investigating how it maintains membrane integrity with a minimal set of lipid-synthesizing enzymes could reveal fundamental principles of membrane biology.

  • Comparative studies with other endosymbionts could identify convergent evolutionary strategies for membrane maintenance under genomic constraints.

3. Host-Symbiont Membrane Interactions:

  • Research on cls could illuminate how Buchnera membranes interact with host-derived membranes that surround the symbiont.

  • This could reveal mechanisms for selective transport of nutrients and metabolites between host and symbiont.

4. Stress Response Mechanisms:

  • Cardiolipin plays important roles in bacterial stress responses. Understanding how Buchnera's cls responds to environmental stressors could reveal adaptations for maintaining symbiotic stability under varying conditions.

  • This has implications for understanding climate resilience in insect-symbiont systems.

5. Evolution of Transport Systems:

  • Genomic analysis of Buchnera has revealed "reduced transporter sets and variable membrane organisations" .

  • Research on cls could help explain how these reduced transport systems function efficiently within specialized membrane environments.

6. Translational Applications:

  • Insights from Buchnera cls could inform strategies for controlling aphid pests by targeting symbiont membrane function.

  • Understanding fundamental principles of minimal membrane systems could inspire biomimetic approaches for designing synthetic cells or organelles.

This research extends beyond Buchnera to inform our understanding of diverse obligate intracellular bacteria, including pathogens and other nutritional symbionts, potentially revealing common principles governing the evolution and function of reduced membrane systems in specialized intracellular environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.