Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant CyoD

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase protein CyoD (cyoD) is a heterologously expressed bacterial protein derived from the pea aphid symbiont Buchnera aphidicola. It serves as subunit IV of the cytochrome o ubiquinol oxidase complex, a terminal oxidase in bacterial electron transport chains. This enzyme catalyzes the transfer of electrons from ubiquinol to oxygen, generating a proton gradient for ATP synthesis .

PropertyDetails
UniProt IDP57541
Gene SymbolcyoD
Host Expression SystemE. coli
TagHis-tag (N-terminal)
Protein Length105 amino acids (AA)
Molecular Weight~12.1 kDa
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 50% glycerol, pH 8.0

Functional Role in Bacterial Respiration

CyoD is essential for the structural and functional integrity of the cytochrome o ubiquinol oxidase complex. Key roles include:

FunctionMechanism
CuB Center StabilizationInteracts with subunit I to maintain the binuclear copper center (CuB)
Subunit AssemblyFacilitates proper folding and assembly of the oxidase complex
Electron TransferSuggested role in optimizing electron flow from ubiquinol to oxygen

Experimental Evidence:

  • Deletion studies in E. coli cyoD homologs showed impaired oxidase activity and disrupted CuB binding .

  • Cross-linking experiments confirmed proximity between CyoD and subunit III, indicating a critical spatial arrangement .

Production and Applications

Recombinant Production

  • Host: E. coli (optimized for high-yield expression).

  • Purification: Affinity chromatography (His-tag), followed by buffer exchange for storage .

  • Storage: Lyophilized or glycerol-stabilized aliquots at -20°C/-80°C .

Research Applications

ApplicationExample
Structural BiologyCrystallization studies for oxidase complex resolution
Biochemical AssaysEnzyme activity measurements in reconstituted membrane systems
Evolutionary StudiesComparative analysis of cytochrome oxidase subunits across bacteria

Comparative Analysis with Orthologs

CyoD orthologs are conserved across Proteobacteria, with functional divergence observed in symbiotic vs. free-living species.

OrganismKey FeatureReference
Buchnera aphidicolaReduced genome but retains cyoD for essential respiration .
Pseudomonas aeruginosacyoD (PA1320) is part of the cytochrome o complex, critical in aerobic growth .
E. colicyoD is essential for CuB center stability; deletion abolishes oxidase activity .

Research Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyoD; BU469; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
cyoD
Target Protein Sequence
MSSFLNFNMNKEMKSYLLGFLFSSLLTTLPFLLAIEKFFCSEVNYIIFLLCAISQIIIHF VYFLHLSFDPEERWNLITLLFVIIIIFIVVFGSIWIMFNLNHNTM
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a component of the aerobic respiratory chain in *E. coli*, which is predominantly expressed when cells are grown under high aeration conditions. This enzyme possesses proton pump activity across the membrane in addition to electron transfer, pumping 2 protons per electron.
Database Links

KEGG: buc:BU469

STRING: 107806.BU469

Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant in endosymbiont research?

Buchnera aphidicola is an obligate bacterial endosymbiont of aphids that supplies essential nutrients lacking in the aphid diet. Most aphids rely on this single bacterial endosymbiont, making it a model system for studying obligate symbiotic relationships . Buchnera has undergone significant genome reduction during its evolutionary history as an endosymbiont, with varying degrees of gene loss across different strains associated with different aphid hosts . This genomic reduction provides unique insights into the evolutionary processes of endosymbiotic bacteria.

The complete genome sequences of several Buchnera strains have been determined, showing variations in genome size ranging from 416,380 bp (B. aphidicola BCc) to 642,454 bp (B. aphidicola BSg), with correspondingly different gene complements . Notably, in some aphid lineages, particularly within the Lachninae subfamily, Buchnera has lost essential symbiotic functions and requires complementation by additional bacterial symbionts like "Candidatus Serratia symbiotica" to fulfill its nutritional role .

What is the cytochrome o ubiquinol oxidase complex and what role does the CyoD subunit play?

Cytochrome o ubiquinol oxidase is one of the terminal oxidases in the bacterial aerobic respiratory chain. In Pseudomonas putida (a well-studied system that provides insights relevant to Buchnera), the cytochrome o oxidase complex is encoded by the cyoABCDE gene cluster, which produces the four subunits of the complex (II, I, III, and IV, also known as A, B, C, and D) and heme o synthase (E) .

The CyoD protein (subunit IV) functions as part of this complex, which transfers electrons from ubiquinol to oxygen during aerobic respiration. Under highly aerobic conditions, the cytochrome o ubiquinol oxidase serves as the main terminal oxidase in the electron transport chain . While the specific role of CyoD hasn't been detailed in the provided search results, studies in related bacterial systems suggest it contributes to the structural integrity and optimal function of the entire cytochrome o complex.

How does the electron transport chain of Buchnera aphidicola compare to free-living bacteria?

Buchnera aphidicola, due to its reduced genome, displays a simplified electron transport chain compared to free-living bacteria. While specific details about Buchnera's respiratory chain are not explicitly described in the search results, we can infer from studies on other bacterial systems that essential components may be conserved.

In free-living bacteria like Pseudomonas putida and Escherichia coli, the aerobic respiratory chain includes multiple membrane-bound dehydrogenases that transfer electrons to ubiquinone, reducing it to ubiquinol. This ubiquinol can then be oxidized by either of two respiratory ubiquinol oxidases: the cytochrome o complex or the cytochrome d complex . Under high oxygen conditions, the cytochrome o oxidase accommodates most of the electron flow, while cytochrome d oxidase serves as an alternative terminal oxidase when oxygen becomes limiting .

Buchnera, with its reduced genome, likely maintains only the most essential components of this respiratory pathway, possibly with adaptations specific to its endosymbiotic lifestyle. The retention of genes encoding respiratory chain components, despite massive gene loss, underscores their critical importance to the bacterium's survival.

What challenges exist in expressing recombinant Buchnera proteins and what methodologies can overcome these limitations?

Expressing recombinant proteins from obligate endosymbionts like Buchnera aphidicola presents several significant challenges:

  • Genomic peculiarities: Buchnera has a highly reduced genome with altered codon usage patterns and A+T bias (G+C content ranges from 20.20% to 26.30% across strains) . This can create expression difficulties in common host systems.

  • Lack of standard culture methods: As an obligate endosymbiont, Buchnera cannot be cultured outside its host, making direct protein extraction impractical.

  • Potential toxicity: Membrane proteins like cytochrome o oxidase components may be toxic when overexpressed in heterologous systems.

Methodological approaches to overcome these challenges:

  • Codon optimization: Adapting the coding sequence to match the codon preference of the expression host (e.g., E. coli) while maintaining the amino acid sequence.

  • Fusion protein strategies: Using solubility-enhancing tags (such as MBP, SUMO, or thioredoxin) to improve expression and folding.

  • Cell-free expression systems: These avoid toxicity issues and can be optimized for membrane protein production.

  • Specialized expression hosts: Using bacterial strains specifically engineered for membrane protein expression, with modified membrane compositions or chaperone co-expression systems.

  • Gene synthesis: Rather than cloning from genomic DNA, synthesizing the entire coding sequence with optimized parameters can improve success rates.

For functional studies, reconstitution of the recombinant protein into liposomes or nanodiscs can provide a membrane-like environment for activity assays.

How does the evolutionary genome reduction in Buchnera affect its respiratory components?

The genome of Buchnera aphidicola has undergone substantial reduction during its evolution as an obligate endosymbiont. Different Buchnera strains show varying degrees of genomic reduction, with the smallest genomes found in strains from the Lachninae subfamily of aphids . This reduction has significant implications for respiratory components:

  • Selective retention: Despite massive gene loss, genes encoding critical respiratory functions are often retained, suggesting they are essential for endosymbiont survival.

  • Strain-specific losses: The comparative analysis of Buchnera genomes reveals lineage-specific patterns of gene loss. The table below shows the variation in gene content across different Buchnera strains:

Genomic propertyBApBSgBBpBCcBCt
Genome size (bp)652,115653,001618,379425,229452,999
Total no. of genes609597546402404
No. of CDS (chromosome + plasmids)562 + 9550 + 9505 + 3358 + 7361 + 6
G+C content (%)26.2426.3025.3020.2025.00
  • Metabolic complementation: In some cases, genes lost from Buchnera are compensated for by the presence of secondary symbionts or by host functions. For instance, in Cinara cedri, Buchnera has lost many metabolic functions that are complemented by "Candidatus Serratia symbiotica" .

  • Structural simplification: Respiratory complexes may retain core catalytic components while losing regulatory or accessory subunits, resulting in simplified but functional systems.

The evolutionary trajectory of respiratory components in Buchnera represents a balance between genome reduction pressure and the maintenance of essential functions required for endosymbiont viability.

What is the relationship between cytochrome o ubiquinol oxidase activity and catabolic repression?

Studies in Pseudomonas putida have revealed a surprising connection between cytochrome o ubiquinol oxidase and catabolic repression mechanisms. While not directly studied in Buchnera, these findings provide valuable insights into how respiratory chain components can influence gene regulation:

This relationship highlights how the respiratory chain can function not only in energy generation but also as a signaling system that influences global gene expression patterns.

What functional assays are appropriate for studying recombinant Buchnera CyoD activity?

Several functional assays can be employed to study the activity of recombinant Buchnera CyoD protein, particularly in the context of the complete cytochrome o ubiquinol oxidase complex:

When designing these assays, it's important to consider the natural environment of the protein. Buchnera, as an endosymbiont, operates in a unique intracellular environment that may affect protein function. Manipulating lipid composition, pH, and ionic strength in in vitro assays may be necessary to approximate physiological conditions.

How does the metabolic interdependence between Buchnera and its aphid host affect respiratory function?

The metabolic interdependence between Buchnera aphidicola and its aphid host has profound implications for understanding the role and regulation of respiratory functions:

  • Nutritional complementation: Buchnera provides essential amino acids and other nutrients to its aphid host, while the host supplies non-essential amino acids, carbon sources, and a stable environment for Buchnera . This metabolic integration likely influences respiratory activity, as energy generation needs to be coordinated with biosynthetic demands.

  • Shared metabolic pathways: In some cases, metabolic pathways are distributed between host and symbiont, requiring coordinated regulation. For example, in the Buchnera from Cinara cedri (BCc), tryptophan biosynthesis requires metabolic complementation with "Candidatus Serratia symbiotica" .

  • Evolutionary implications: The massive gene loss in Buchnera genomes (as shown in the table below) reflects adaptation to the stable host environment and metabolic complementation with the host:

Genomic propertyValue for B. aphidicola strain
Genome size (chromosome) (bp)640,681 (BAp)
No. of CDS (chromosome)562 (BAp)
G+C content (%)26.24 (BAp)
  • Resource allocation: With limited genetic capacity, Buchnera must optimize resource allocation between respiratory energy generation and biosynthetic functions that benefit the host. The retention of respiratory genes despite genome reduction suggests their critical importance.

  • Signal integration: Respiratory functions likely respond to signals from the host environment, such as nutrient availability or developmental cues. The observation that cytochrome o ubiquinol oxidase can influence gene regulation in other bacterial systems suggests potential mechanisms for integrating host-derived signals with bacterial physiology .

Understanding this metabolic interdependence requires integrated approaches that consider both host and symbiont physiology, as well as the evolutionary context of the relationship.

What are the most effective approaches for cloning and expressing Buchnera aphidicola genes?

Given the challenges associated with Buchnera's unculturable nature and genomic peculiarities, researchers have developed specialized approaches for studying its genes:

  • PCR amplification from aphid tissue: The search results describe using PCR to close genomic gaps during Buchnera genome sequencing, with sets of specific primers designed based on draft genome assemblies . This approach can be adapted for cloning specific genes like cyoD.

  • Genome-guided synthesis: With the complete genome sequences available for multiple Buchnera strains, gene synthesis offers an alternative to direct cloning, allowing optimization of codon usage for the expression host.

  • Expression vector selection: For membrane proteins like CyoD, specialized vectors that allow tight control of expression levels and fusion to solubility-enhancing tags can improve success rates. Vectors with temperature-inducible or tunable promoters help manage potential toxicity.

  • Host strain considerations: E. coli strains specifically designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) may enhance the production of functional CyoD protein.

  • Expression verification: Western blotting with antibodies against affinity tags or the protein itself, combined with mass spectrometry, can confirm successful expression. For membrane proteins like CyoD, membrane fractionation is essential to verify proper localization.

These approaches have enabled functional studies of various Buchnera proteins despite the challenges posed by its obligate endosymbiotic lifestyle.

How can researchers study the evolutionary history of respiratory proteins across Buchnera strains?

Studying the evolutionary history of respiratory proteins like CyoD across Buchnera strains requires specialized approaches due to the unique evolutionary trajectory of this endosymbiont:

  • Comparative genomics: Analysis of gene content across different Buchnera strains reveals patterns of gene loss and retention. The search results describe the inference of the last common ancestor's gene repertoire and analysis of metabolic losses across different lineages . Similar approaches can be applied specifically to respiratory genes.

  • Phylogenetic analysis: Constructing phylogenetic trees of Cyo proteins from various Buchnera strains and related free-living bacteria helps reconstruct the evolutionary history of these proteins. This approach can identify selective pressures acting on respiratory genes.

  • Synteny analysis: Examining the genomic context of respiratory genes across strains can provide insights into genome rearrangements and the stability of operons. The search results mention using genomic synteny to aid in contig assembly , but this approach can also inform evolutionary studies.

  • Selection analysis: Calculating dN/dS ratios (the ratio of non-synonymous to synonymous substitutions) for respiratory genes across strains can identify whether they are under purifying selection, which would suggest functional conservation despite genome reduction.

  • Ancestral sequence reconstruction: Computational methods can infer the sequences of ancestral respiratory proteins, which can then be synthesized and functionally characterized to understand the evolutionary trajectory of protein function.

These approaches collectively provide insights into how respiratory functions have evolved in response to the unique selective pressures of the endosymbiotic lifestyle.

What is known about the interplay between Buchnera respiratory functions and secondary symbionts?

The relationship between Buchnera respiratory functions and secondary symbionts represents an emerging frontier in endosymbiont research:

  • Co-obligate symbioses: In some aphids, particularly from the Lachninae subfamily, Buchnera has lost essential symbiotic functions and is complemented by secondary symbionts like "Candidatus Serratia symbiotica" . These losses may include genes involved in the biosynthesis of essential amino acids or other nutrients.

  • Differential relationships: Different Buchnera strains exhibit varying relationships with secondary symbionts. For example, while "Candidatus Serratia symbiotica" is present in both C. cedri and C. tujafilina, it belongs to different clades in these two hosts and has different functional relationships with Buchnera .

  • Evolutionary implications: The search results suggest that the association with facultative symbionts occurred in the common ancestor of the Lachninae lineage, "allowing the massive gene loss that took place at that point in its evolution" . This indicates that secondary symbionts can create conditions permitting further genome reduction in Buchnera.

  • Metabolic complementation: In C. cedri, Buchnera requires metabolic complementation with "Candidatus Serratia symbiotica" for tryptophan biosynthesis, while in C. tujafilina, the Buchnera strain can synthesize tryptophan independently . This demonstrates how the specific metabolic capabilities of secondary symbionts influence the retention or loss of metabolic pathways in Buchnera.

  • Physiological coordination: The presence of multiple bacterial symbionts in a single host requires coordination of metabolic and respiratory activities. How respiratory functions in Buchnera respond to or coordinate with the activities of secondary symbionts remains largely unexplored.

This area represents a promising direction for future research, particularly in understanding how multi-partner symbioses evolve and function at the biochemical level.

How might knowledge of cytochrome o ubiquinol oxidase function inform synthetic biology approaches in endosymbiont research?

Understanding cytochrome o ubiquinol oxidase function opens several avenues for synthetic biology applications in endosymbiont research:

  • Minimal genome design: The selective retention of respiratory genes in highly reduced Buchnera genomes suggests they are essential components of minimal bacterial genomes. This knowledge can inform the design of synthetic minimal genomes for biotechnological applications.

  • Engineered symbionts: Insights into how respiratory functions support endosymbiotic relationships could guide the engineering of novel synthetic symbionts with tailored functions for agricultural or medical applications.

  • Metabolic optimization: The link between respiratory function and catabolic repression observed in P. putida suggests that modulating respiratory components could be a strategy to optimize metabolic flux in engineered bacteria.

  • Biosensors: The sensitivity of cytochrome o ubiquinol oxidase to the redox state and its influence on gene regulation could be exploited to design cellular biosensors that respond to specific metabolic conditions.

  • Host-microbe interface engineering: Understanding how respiratory functions in Buchnera are adapted to the host environment could inform the design of synthetic microbes that can establish stable associations with eukaryotic hosts.

These synthetic biology applications represent the translation of fundamental knowledge about bacterial respiratory functions into novel biotechnological tools and strategies.

What are the most promising directions for future research on Buchnera respiratory proteins?

Several promising research directions emerge from current understanding of Buchnera respiratory proteins:

These research directions would significantly advance our understanding of how respiratory functions have adapted to the endosymbiotic lifestyle and contribute to the remarkable evolutionary success of the aphid-Buchnera symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.