Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase subunit 3 (cyoC)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola and cyoC

Buchnera aphidicola is a primary obligate bacterial endosymbiont that has coevolved with modern aphids, as evidenced by molecular phylogenetic analyses . The subspecies found in Acyrthosiphon pisum (pea aphid) represents one of the most well-studied endosymbiotic relationships in insect biology. Within this bacterium, Cytochrome o ubiquinol oxidase subunit 3, encoded by the cyoC gene (also known as BU470), functions as a critical component of the respiratory electron transport chain .

The cyoC protein is part of the cytochrome bo3 ubiquinol oxidase complex, which serves as the terminal oxidase in the aerobic respiratory chain. This complex catalyzes the four-electron reduction of molecular oxygen to water while simultaneously pumping protons across the membrane, contributing to the establishment of the proton motive force necessary for ATP synthesis. The recombinant form of this protein has been developed to facilitate research into this specialized bacterial system and its evolutionary relationship with its aphid host.

Physical and Biochemical Properties

The cyoC protein exhibits hydrophobic characteristics typical of membrane proteins involved in electron transport. The recombinant version is typically produced with an N-terminal His-tag to facilitate purification and downstream applications . The commercial preparations of this protein achieve greater than 90% purity as determined by SDS-PAGE analysis .

PropertySpecification
Protein LengthFull Length (1-205 amino acids)
Molecular TagN-terminal His tag
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Physical FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDP57542

Recombinant Expression Systems

The recombinant cyoC protein is primarily expressed in E. coli expression systems . This heterologous expression approach allows for efficient production of the protein for research purposes. The bacterial expression system provides several advantages, including rapid growth, high protein yields, and well-established protocols for induction and harvesting.

Purification and Quality Control

Purification of the recombinant cyoC protein typically leverages the N-terminal His-tag through affinity chromatography techniques. This approach allows for selective binding of the tagged protein to metal-chelating resins, followed by elution under specific conditions. The purified protein undergoes quality control assessment through SDS-PAGE analysis to confirm size, purity, and integrity .

Commercial preparations of this protein maintain strict quality standards, with products generally exceeding 85-90% purity . This high-purity preparation ensures reliability in downstream applications and experimental reproducibility.

The Cytochrome o Ubiquinol Oxidase Complex

The cytochrome o ubiquinol oxidase complex in Buchnera aphidicola consists of multiple subunits that work together to perform its respiratory function. The cyoC protein is one component of this larger complex, which also includes cyoA, cyoB, and cyoD subunits .

SubunitFull NameGene NamesFunction
cyoAUbiquinol oxidase subunit 2cyoA; BU472Cytochrome O ubiquinol oxidase subunit II
cyoBUbiquinol oxidase subunit 1cyoBCytochrome O ubiquinol oxidase subunit I
cyoCCytochrome o ubiquinol oxidase subunit 3cyoC; BU470Cytochrome O ubiquinol oxidase subunit III
cyoDCytochrome o ubiquinol oxidase protein CyoDcyoD; BU469Cytochrome O ubiquinol oxidase subunit IV

Each of these components plays a specific role in the function of the complex, with cyoB typically containing the catalytic site for oxygen reduction, while cyoC, cyoA, and cyoD provide structural support and facilitate electron transfer .

Functional Relationships in the Respiratory Chain

The cytochrome o ubiquinol oxidase complex functions within the broader context of the bacterial respiratory chain. In this system, it acts as a terminal oxidase, accepting electrons from ubiquinol and transferring them to molecular oxygen, the final electron acceptor. This process is coupled to proton translocation across the membrane, contributing to the generation of the proton motive force necessary for ATP synthesis.

The ATP synthase complex, which includes subunits like atpD (ATP synthase subunit beta), atpE (ATP synthase subunit c), and atpF (ATP synthase subunit b), utilizes the proton gradient established by the activities of proteins like cyoC to generate ATP . This highlights the integrated nature of these respiratory and energy production systems in the highly specialized Buchnera metabolism.

Current Research Applications

The recombinant cyoC protein has several important applications in research:

  1. Structural and functional studies of bacterial respiratory complexes

  2. Investigation of the metabolic capabilities of Buchnera aphidicola

  3. Evolutionary studies examining the coevolution of Buchnera and its aphid hosts

  4. Development of antibodies and other research tools for studying endosymbiotic systems

  5. Comparative biochemical analyses across different bacterial species

Significance in Understanding Endosymbiotic Relationships

The study of proteins like cyoC from Buchnera aphidicola provides valuable insights into the nature of obligate endosymbiotic relationships. These relationships have resulted from millions of years of coevolution between aphids and their bacterial symbionts . The highly specialized and reduced genome of Buchnera reflects its adaptation to the intracellular environment and its metabolic interdependence with the host.

By studying the structure, function, and evolution of key proteins like cyoC, researchers can better understand the molecular basis of this symbiotic relationship and potentially apply these insights to broader questions in evolutionary biology, microbiology, and insect physiology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyoC; BU470; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
cyoC
Target Protein Sequence
MIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNISINLI SNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKRIKMIYSFLTITFIFGLIFLLMEVHE FYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIRTRILC FSVFWHFLDIIWICVFTFVYLNGAI
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a component of the aerobic respiratory chain in *E. coli* that predominates when cells are grown under high aeration conditions. It exhibits proton pump activity across the membrane alongside electron transfer, pumping 2 protons per electron.
Database Links

KEGG: buc:BU470

STRING: 107806.BU470

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of Cytochrome o ubiquinol oxidase subunit 3 (cyoC) in Buchnera aphidicola?

Cytochrome o ubiquinol oxidase subunit 3 (cyoC) in Buchnera aphidicola functions as a component of the aerobic respiratory chain. Based on comparative studies with similar systems, cyoC plays a crucial role in generating proton motive force by transferring protons across the inner membrane with high efficiency, specifically pumping approximately 2 protons per electron . This proton gradient is essential for ATP synthesis in this endosymbiotic bacterium with its highly reduced genome. The function of cyoC must be understood within the context of Buchnera's limited metabolic capabilities, as its genome has undergone extensive reduction to only 641 kb (containing just 583 protein-coding genes) compared to free-living relatives like E. coli with a 4.6 Mb genome .

How does the genomic context of Buchnera aphidicola affect cyoC expression and function?

The genomic context of Buchnera aphidicola significantly impacts cyoC expression and function due to the bacterium's extreme genome reduction. Unlike free-living bacteria, Buchnera has lost numerous regulatory elements and metabolic pathways through evolutionary genome streamlining . The genome contains no genes acquired through lateral gene transfer, which limits adaptive potential . This genomic reduction means cyoC likely operates with minimal regulatory control and potentially serves essential functions that cannot be compensated for by redundant systems. Research approaches must account for these constraints when designing experiments to study cyoC expression patterns and functional significance in the Buchnera-aphid system.

What methodological approaches are recommended for purifying recombinant Buchnera aphidicola cyoC?

For purifying recombinant Buchnera aphidicola cyoC, researchers should employ heterologous expression systems, as Buchnera itself cannot be cultured independently of its host. A recommended protocol involves:

  • Gene synthesis based on the published Buchnera aphidicola genome sequence

  • Codon optimization for the expression host (typically E. coli)

  • Cloning into an expression vector with an appropriate affinity tag (His6 or GST)

  • Expression in E. coli under microaerobic conditions to facilitate proper folding

  • Membrane protein extraction using mild detergents (DDM or LDAO)

  • Purification via affinity chromatography followed by size exclusion chromatography

This approach accounts for the membrane-associated nature of cyoC while maximizing yield and purity for subsequent functional studies .

How can researchers effectively design experiments to study the function of cyoC in the context of the aphid-Buchnera symbiosis?

To effectively study cyoC function within the aphid-Buchnera symbiosis, researchers should employ a multifaceted approach that accounts for the obligate nature of this relationship. A comprehensive experimental design would include:

  • Transcriptomic analysis comparing cyoC expression levels across different aphid developmental stages and physiological conditions

  • Localization studies using immunofluorescence with anti-cyoC antibodies in bacteriocytes

  • Metabolic flux analysis measuring oxygen consumption and ATP production in isolated bacteriocytes

  • Comparative analyses with similar respiratory components in related systems

  • RNAi approaches targeting host factors that might regulate cyoC expression

This experimental framework acknowledges that direct genetic manipulation of Buchnera is challenging due to its unculturable nature. Instead, it focuses on contextual understanding of cyoC function through host manipulation and comparative approaches. Special consideration should be given to the bacteriocyte environment, as this specialized cell houses Buchnera and likely provides unique conditions affecting cyoC function .

What analytical techniques provide the most reliable data on cyoC activity in membrane preparations?

For analyzing cyoC activity in membrane preparations, the following analytical techniques provide reliable and complementary data:

TechniqueMeasurementAdvantagesLimitations
Oxygen electrode polarographyReal-time O₂ consumptionDirect functional measurementCannot distinguish between oxidases
Spectrophotometric ubiquinol oxidationDecrease in reduced ubiquinolSpecific to ubiquinol oxidasesRequires pure preparation
Proton translocation assaysH⁺ movement across membranesDirectly measures proton pumpingComplex setup, sensitive to conditions
Site-directed fluorescence labelingConformational changesProvides structural insightsRequires protein engineering
Inhibitor studies (with cyanide)Differential inhibitionDistinguishes cytochrome typesNon-specific effects possible

For optimal results, researchers should employ multiple techniques in parallel, as each provides different insights into cyoC function. When working with recombinant Buchnera aphidicola cyoC, it's particularly important to verify that the protein is correctly folded and inserted into the membrane before conducting activity assays, as improper membrane integration significantly impacts function .

How can metabolic flux analysis be adapted to study cyoC's role in the Buchnera-aphid symbiotic system?

Adapting metabolic flux analysis to study cyoC's role in the Buchnera-aphid symbiotic system requires specialized approaches that account for the compartmentalized nature of this symbiosis. A methodological framework should include:

  • Isotope labeling using ¹³C-labeled asparagine (the dominant amino acid in aphid phloem sap, comprising up to 70% of total amino acids)

  • Isolation of intact bacteriocytes to maintain the symbiotic environment

  • Measurement of oxygen consumption rates under different substrate conditions

  • Analysis of ATP production coupled to respiratory activity

  • Integration of data into a genome-scale metabolic model of the Buchnera-aphid system

How can comparative genomics be leveraged to understand cyoC evolution and adaptation in the Buchnera-aphid symbiosis?

Comparative genomics offers powerful insights into cyoC evolution and adaptation in the Buchnera-aphid symbiosis. A comprehensive research methodology should include:

  • Sequence alignment of cyoC across multiple Buchnera strains from different aphid species

  • Calculation of dN/dS ratios to determine selective pressure on cyoC

  • Structural modeling to identify conserved functional domains

  • Comparison with homologous proteins in free-living relatives

  • Correlation of sequence variations with host ecological niches

What methodological approaches can resolve conflicts in experimental data regarding cyoC function in respiratory chains?

Resolving conflicts in experimental data regarding cyoC function requires a systematic approach incorporating multiple methodologies:

  • Controlled expression studies comparing wild-type and mutant cyoC variants

  • Direct measurement of proton translocation efficiency using pH-sensitive fluorescent probes

  • Complementation studies in E. coli cyoC knockout strains

  • Protein-protein interaction analyses to identify all components of the respiratory complex

  • Kinetic measurements under varying oxygen tensions to determine oxygen affinity

When confronted with contradictory data, researchers should carefully consider experimental conditions, particularly oxygen levels, which significantly affect respiratory chain component expression. Evidence from E. coli studies shows that expression patterns of cytochrome oxidases can shift dramatically during adaptation processes, with cyoC increasing expression while alternative oxidases like cydB decrease . This suggests that experimental conditions may need to be standardized across studies to obtain comparable results. Additionally, researchers should examine whether measured differences reflect genuine biological variation or methodological discrepancies.

How can researchers effectively study the relationship between cyoC expression and proton motive force generation in Buchnera?

To effectively study the relationship between cyoC expression and proton motive force (pmf) generation in Buchnera, researchers should implement:

  • Membrane potential measurements using voltage-sensitive fluorescent dyes in isolated bacteriocytes

  • Correlation of cyoC transcript levels with ATP production rates

  • Comparative analysis with other pmf-generating systems in Buchnera

  • Development of a bacteriocyte-specific reporter system for real-time pmf monitoring

  • Mathematical modeling of the relationship between cyoC expression and energy production

This integrated approach acknowledges the challenge of directly manipulating Buchnera while providing multiple lines of evidence regarding cyoC's contribution to energy metabolism. Research in other systems has demonstrated that cyoC has higher efficiency in generating pmf (2 protons/electron) compared to alternative oxidases like cydB (1 proton/electron) . This efficiency difference may be particularly significant in the energy-limited environment of an intracellular symbiont with a restricted diet based primarily on phloem sap amino acids like asparagine .

How does cyoC function integrate into the broader metabolic network of the Buchnera-aphid symbiosis?

The function of cyoC integrates into the broader metabolic network of the Buchnera-aphid symbiosis through its essential role in energy production supporting amino acid biosynthesis. A systems biology perspective reveals:

  • Proton motive force generated via cyoC-containing respiratory complexes drives ATP synthesis

  • This ATP powers amino acid biosynthetic pathways that produce essential amino acids for the aphid host

  • The aphid supplies non-essential amino acids (primarily asparagine from phloem sap) that serve as carbon and nitrogen sources for Buchnera

  • Efficient respiratory function via cyoC likely represents an adaptation to maximize energy production from limited substrates

This metabolic integration highlights why respiratory efficiency through components like cyoC is crucial to symbiotic function. In the context of Buchnera's extremely reduced genome (641 kb) and limited metabolic capabilities, the retention of the cytochrome o oxidase complex underscores its importance . Researchers should examine cyoC function not in isolation but as part of this interdependent metabolic network where energy production is tightly coupled to amino acid metabolism supporting both partners.

What methodological approaches best capture the interplay between host factors and Buchnera cyoC expression?

To effectively capture the interplay between host factors and Buchnera cyoC expression, researchers should implement:

  • Dual RNA-seq of both aphid bacteriocytes and Buchnera under varying physiological conditions

  • Proteomic analysis of the symbiosomal membrane to identify potential regulatory proteins

  • Functional assays measuring cyoC activity in bacteriocytes isolated from aphids with different genetic backgrounds

  • Investigation of host-derived signals that might regulate Buchnera metabolism

  • Analysis of laterally transferred genes of bacterial origin in the aphid genome that might interact with Buchnera processes

This multimodal approach acknowledges the complex regulatory landscape at the host-symbiont interface. Research has identified aphid genes of bacterial origin (including LdcA, AmiD, and the RlpA family) that are upregulated in bacteriocytes and may influence bacterial functions . Of particular interest are genes containing N-terminal eukaryotic-type signal peptides that may target proteins to Buchnera via the symbiosomal membrane. Investigating whether any of these host factors specifically interact with respiratory components like cyoC would provide valuable insights into symbiotic coordination.

How can genome-scale metabolic modeling be applied to understand cyoC's contribution to symbiotic fitness?

Genome-scale metabolic modeling provides a powerful framework for understanding cyoC's contribution to symbiotic fitness through the following methodological approach:

  • Construction of a joint metabolic model incorporating both Buchnera and aphid bacteriocyte metabolism

  • Integration of transcriptomic data to constrain flux distributions

  • In silico knockdown of cyoC activity to predict system-wide metabolic consequences

  • Sensitivity analysis to identify conditions where cyoC function becomes limiting

  • Comparison of alternative respiratory configurations to evaluate evolutionary optimization

This computational approach complements experimental studies by predicting emergent properties of the symbiotic system. Research on other systems has employed similar approaches, integrating gene expression data into genome-scale metabolic models to identify reprogrammed genes during adaptation processes . For Buchnera, such modeling could reveal how cyoC activity influences the production of essential amino acids for the host while managing the energetic constraints of endosymbiotic life. This approach can generate testable hypotheses about the conditions under which respiratory efficiency might limit symbiotic performance.

How does cyoC in Buchnera compare functionally to homologous proteins in free-living bacteria like E. coli?

Comparing cyoC in Buchnera to homologous proteins in free-living bacteria reveals important functional adaptations to symbiotic life:

FeatureBuchnera cyoCE. coli cyoCSignificance
Sequence conservationReducedReferenceReflects genome streamlining
Regulatory elementsMinimalComplexLoss of conditional regulation
Expression patternConstitutiveOxygen-responsiveAdaptation to stable environment
Proton pumping efficiencyPresumably preserved2 H⁺/e⁻Energetic importance maintained
Alternative oxidasesFew or absentMultiple (e.g., cydB)Reduced metabolic flexibility

In E. coli, cyoC expression is dynamic and responds to environmental conditions, with studies showing significant reprogramming during adaptation, including increased cyoC expression coupled with decreased expression of the less efficient cydB . In contrast, Buchnera's gene regulatory capabilities are severely limited due to genome reduction . The retention of cyoC in Buchnera's highly reduced genome suggests its function remains essential despite the loss of many other metabolic capabilities, likely because the efficient proton pumping it provides is crucial for generating sufficient energy in the resource-limited symbiotic environment.

What analytical approaches best determine if Buchnera cyoC has undergone adaptive evolution for symbiotic function?

To determine if Buchnera cyoC has undergone adaptive evolution for symbiotic function, researchers should employ these analytical approaches:

  • Codon-based analyses to identify sites under positive selection

  • Ancestral sequence reconstruction to trace evolutionary changes

  • Homology modeling to map sequence changes onto protein structure

  • Comparative biochemical assays with reconstructed ancestral proteins

  • Analysis of coevolutionary patterns with interacting proteins

This multifaceted approach can reveal whether cyoC has experienced symbiosis-specific adaptation. When analyzing sequence evolution, particular attention should be paid to sites that interact with other respiratory complex components or that influence proton translocation efficiency. The extreme AT-richness of the Buchnera genome must be considered when interpreting evolutionary signatures . Additionally, researchers should examine whether cyoC evolution correlates with host adaptations or with ecological factors affecting the aphid-Buchnera relationship.

How can researchers effectively design experiments to compare respiratory efficiency between different Buchnera strains with variant cyoC sequences?

To compare respiratory efficiency between Buchnera strains with variant cyoC sequences, researchers should implement:

  • Isolation of bacteriocytes from different aphid species or lineages

  • Standardized oxygen consumption measurements using high-resolution respirometry

  • ATP production assays under controlled substrate conditions

  • Correlation of functional measurements with cyoC sequence variations

  • Expression of variant cyoC proteins in a model system for direct comparison

This experimental design controls for host effects while focusing on the functional consequences of cyoC sequence variation. The availability of multiple sequenced Buchnera strains, including eight from A. pisum alone , provides natural variants for comparative analysis. When interpreting results, researchers should consider the holistic nature of respiratory efficiency, which depends not only on cyoC but on all components of the electron transport chain and the broader metabolic network. Additionally, the specific nutrient environment of different aphid host species, particularly the amino acid composition of their diet, may influence respiratory requirements and should be accounted for in comparative analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.