Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Symbiosis

RnfE operates within the electron transport chain to generate energy for amino acid biosynthesis, a process vital for the aphid’s survival on nutrient-poor phloem sap. Key findings:

  • Metabolic Complementarity: Buchnera supplies essential amino acids (e.g., leucine, tryptophan) to the aphid, relying on Rnf complexes for redox balancing .

  • Gene Localization: Unlike leuABCD and trpEG (plasmid-borne amplified genes), rnfE remains chromosomally encoded, suggesting conserved function .

  • Proteomic Stability: RnfE exhibits consistent expression across aphid color morphs (green/orange), with spectral counts varying by <15% in quantitative assays .

Expression and Purification

  • Host Strain: Expressed in E. coli BL21 or similar strains under optimized codon usage .

  • Yield: ~50 µg per batch in Tris-based formulations, verified via SDS-PAGE and mass spectrometry .

Research Applications

ApplicationUse Case
Antibody DevelopmentImmunogen for raising anti-RnfE antibodies to study symbiosomal membrane dynamics
Functional AssaysElectrophysiological characterization of ion transport in Xenopus oocyte systems
Metabolic ModelingIntegration into genome-scale models of Buchnera-aphid amino acid exchange

Proteomic Quantification in Aphid Morphs

A comparative study of Buchnera density in green vs. orange A. pisum revealed:

ParameterGreen AphidOrange Aphid
RnfE Spectral Counts1,318 (pellet + supernatant)1,177 (pellet + supernatant)
RPKM (RNA-Seq)8.92% of total mRNA8.31% of total mRNA
Protein-RNA CorrelationWeak (R² = 0.24)Weak (R² = 0.19)

Data normalized using ribosomal protein spectra

Evolutionary Conservation

  • Gene Conversion: repA1/repA2 paralogs in Buchnera plasmids show identical nucleotide stretches (59–126 bp), but rnfE lacks such plasticity, indicating evolutionary constraint .

  • Horizontal Transfer: No evidence of lateral rnfE transfer exists, unlike plasmid-borne leuABCD .

Challenges and Future Directions

  • Functional Redundancy: RnfE’s role overlaps with other Rnf subunits (RnfA-RnfG), complicating knockout studies .

  • Membrane Localization: Immunocytochemistry confirms RnfE’s presence in Buchnera membranes, but transport mechanisms remain unresolved .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rnfE; BU118; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
BU118
Target Protein Sequence
MNIKSFLNNRLWKNNSSLVQLLGLCPVLAMTTNAINAIGLGMTTTLVLTITNTIISSFRK IIPKDLRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLIVTNCIIVGRADLIAYK SSIVESFFDGIFIGLGSMFAMFAVGSIREILGNGTLFFGANKIISNIHSSVFFTLLDKKF TIILAVFPPGGFLILGFLIAIKNFIDLYYKKNTIKNIEQCSCSNKIK
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links

KEGG: buc:BU118

STRING: 107806.BU118

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant RnfE protein typically expressed and purified for research use?

Recombinant Buchnera aphidicola RnfE protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression in E. coli is preferred due to the prokaryotic origin of the protein and the well-established protocols for bacterial protein expression.

Methodology for expression and purification:

  • Clone the full-length gene (corresponding to amino acids 1-227) into an expression vector with an N-terminal His-tag

  • Transform into an E. coli expression strain

  • Induce protein expression using appropriate conditions

  • Lyse cells and purify using nickel affinity chromatography

  • Perform buffer exchange and concentrate as needed

  • Lyophilize the purified protein for long-term storage

For reconstitution, it is recommended to:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What are the challenges in working with membrane proteins like RnfE from obligate symbionts?

Working with membrane proteins like RnfE from obligate symbionts presents several unique challenges:

  • Expression difficulties: Membrane proteins often form inclusion bodies or exhibit toxicity to the host cells during overexpression.

  • Limited natural abundance: As Buchnera aphidicola is an obligate symbiont with reduced genome size, obtaining sufficient quantities from natural sources is impractical.

  • Proper folding concerns: Ensuring the recombinant protein adopts the native conformation, especially for membrane proteins with transmembrane domains.

  • Stability issues: Membrane proteins generally require detergents or lipid environments for stability, which can interfere with downstream applications.

  • Functional validation: Since Buchnera cannot be cultured independently, validating protein function is challenging and often requires reconstitution approaches.

Methodological solutions:

  • Use specialized E. coli strains designed for membrane protein expression

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Test various detergents for solubilization and stabilization

  • Consider fusion partners that enhance solubility

  • Implement reconstitution in liposomes for functional studies

How do mutations in the RnfE protein affect its function within the electron transport complex?

Mutations in the RnfE protein can significantly impact the function of the entire Rnf complex. Recent research on Buchnera has revealed that even closely related haplotypes can be subject to strong within-host selection, with selection coefficients as high as 0.5 per aphid generation .

Key considerations for mutation studies:

  • Thermal environment effects: The direction of selection for different Buchnera haplotypes can depend on thermal conditions, suggesting that mutations in proteins like RnfE might confer different advantages under varying temperatures .

  • Within-host selection: Even mutations with little impact on host-level fitness can experience strong within-host selection, potentially accelerating sequence evolution of the symbiont .

  • Bottleneck effects: The small effective population size of Buchnera within hosts (10-20) indicates a strong potential for genetic drift and fixation of mutations, including potentially deleterious ones .

For researchers studying the effects of mutations in RnfE, site-directed mutagenesis approaches targeting conserved residues followed by functional assays would be most informative. Key targets might include residues involved in:

  • Membrane integration

  • Ion channel formation

  • Interaction with other Rnf complex subunits

  • Electron transfer sites

What experimental approaches are optimal for studying the ion-translocating function of the Rnf complex containing RnfE?

Studying the ion-translocating function of the Rnf complex requires specialized techniques that can detect and measure ion movements across membranes:

Methodological approaches:

  • Liposome reconstitution:

    • Purify all six Rnf complex subunits (including RnfE)

    • Reconstitute into liposomes with controlled lipid composition

    • Load liposomes with ion-sensitive fluorescent dyes

    • Monitor changes in fluorescence upon addition of electron donors/acceptors

  • Electrophysiology techniques:

    • Patch-clamp recordings of proteoliposomes containing the reconstituted complex

    • Planar lipid bilayer recordings to measure ion conductance

  • Ion specificity determination:

    • Compare Na⁺ versus H⁺ translocation using specific ionophores and inhibitors

    • Perform ion-replacement experiments to determine specificity

It's important to note that some Rnf complexes use Na⁺ as a coupling ion while others use protons, correlating with the ion specificity of the ATP synthase in the organism . For Buchnera aphidicola, determining which ion is used would provide insights into its bioenergetic mechanisms.

How can RnfE function be analyzed in the context of the drastically reduced genome of Buchnera aphidicola?

Analyzing RnfE function within the context of Buchnera's reduced genome requires approaches that account for the loss of regulatory elements and the streamlined metabolism:

Research strategies:

  • Comparative genomics approach:

    • Analyze the conservation of Rnf complex genes across different Buchnera strains

    • Identify potential compensatory mechanisms for functions lost during genome reduction

    • Compare with free-living relatives to understand adaptation to the symbiotic lifestyle

  • Transcriptional context analysis:

    • Examine the genomic neighborhood of rnfE for conservation of transcriptons (co-regulated gene sets)

    • Study the σ70 promoter region characteristics, as these are present upstream of about 94% of Buchnera CDS

    • Analyze whether rnfE has unstable σ70 promoters, which are specifically associated with regulator and transporter genes in Buchnera

  • Metabolic integration studies:

    • Map how the Rnf complex and RnfE fit into the reduced metabolic network of Buchnera

    • Identify essential metabolic pathways that depend on RnfE function

    • Explore how loss of alternative energy-generating pathways affects the importance of the Rnf complex

What is the significance of RnfE in the Buchnera-aphid symbiotic relationship?

The Rnf complex, including RnfE, likely plays a crucial role in the Buchnera-aphid symbiotic relationship through its involvement in energy metabolism:

Key aspects:

  • Energy provision in nutrient-limited environment:

    • The Rnf complex may be essential for generating ion gradients that drive ATP synthesis in the nutrient-limited intracellular environment

    • This energy is critical for Buchnera to synthesize essential amino acids required by the aphid host

  • Adaptation to symbiotic lifestyle:

    • Strong within-host selection (selection coefficients up to 0.5) has been observed in Buchnera

    • This selection could act on genes like rnfE to optimize energy metabolism for the intracellular environment

  • Environmental responsiveness:

    • The direction of selection in Buchnera haplotypes can depend on the thermal environment

    • The Rnf complex might play a role in adapting to different thermal conditions experienced by the aphid host

  • Metabolic integration:

    • As part of Buchnera's streamlined metabolism, the Rnf complex likely represents an indispensable component that cannot be lost despite genome reduction

    • Conservation of gene neighborhoods (transcriptons) between E. coli and Buchnera suggests selective pressure on maintaining certain functional associations

What techniques can be used to study protein-protein interactions between RnfE and other subunits of the Rnf complex?

Several techniques can be employed to study protein-protein interactions between RnfE and other Rnf complex subunits:

Recommended approaches:

  • Co-immunoprecipitation with tagged proteins:

    • Express His-tagged RnfE together with differently tagged versions of other Rnf subunits

    • Perform pull-down assays to identify interacting partners

    • Confirm interactions using reverse pull-downs with different tagged subunits

  • Bacterial two-hybrid system:

    • Particularly useful for membrane proteins

    • Fuse RnfE and potential interacting partners to split reporter domains

    • Measure reporter activity as an indication of protein-protein interaction

  • Cross-linking mass spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Identify cross-linked peptides to map interaction interfaces

  • FRET (Förster Resonance Energy Transfer):

    • Tag RnfE and other subunits with fluorescent proteins or dyes

    • Measure energy transfer as indication of proximity

    • Can be performed in membrane systems to maintain native environment

  • Structural analysis:

    • Cryo-electron microscopy of reconstituted complexes

    • Negative staining EM for initial characterization

    • Cross-validation with computational prediction of interaction sites

How can researchers overcome the challenges of Buchnera's uncultivability when studying RnfE function?

The inability to culture Buchnera independently presents significant challenges for studying proteins like RnfE. Here are methodological approaches to overcome this limitation:

Strategies:

  • Heterologous expression systems:

    • Express recombinant RnfE in E. coli as described

    • Use purified components for in vitro reconstitution studies

    • Create chimeric proteins with homologous domains from culturable organisms

  • In situ approaches:

    • Develop methods to study the protein directly in bacteriocytes (specialized aphid cells housing Buchnera)

    • Use fluorescent antibodies against RnfE for localization studies

    • Apply metabolic labeling to track protein synthesis and turnover

  • Complementation studies:

    • Express Buchnera RnfE in E. coli strains with deleted or modified native rnf genes

    • Assess functional complementation through growth or biochemical assays

    • Use this system to test mutant variants of RnfE

  • Comparative studies with model systems:

    • Leverage knowledge from well-characterized Rnf complexes in other organisms

    • Focus on conserved features to infer function

    • Use site-directed mutagenesis to test specific hypotheses

  • Systems biology approach:

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Develop predictive models of RnfE function within the Buchnera metabolic network

    • Validate predictions through targeted experiments

What considerations are important when designing experiments to study the impact of thermal conditions on RnfE function?

Given that the direction of selection in Buchnera can depend on thermal environment , designing experiments to study temperature effects on RnfE function requires careful consideration:

Experimental design considerations:

  • Temperature range selection:

    • Include temperatures relevant to the aphid's natural habitat (typically 15-30°C)

    • Test extreme temperatures to identify thermal stability limits

    • Use gradual temperature shifts to mimic natural conditions

  • Activity assays across temperature range:

    • Measure electron transfer rates at different temperatures

    • Assess ion translocation efficiency as a function of temperature

    • Determine thermal stability profile using differential scanning fluorimetry

  • Structural stability analysis:

    • Monitor protein folding and membrane integration at various temperatures

    • Use circular dichroism spectroscopy to assess secondary structure changes

    • Employ limited proteolysis to identify thermally sensitive regions

  • In vivo relevance:

    • Design experiments that connect in vitro findings to the aphid-Buchnera system

    • Consider how temperature affects the metabolic needs of the host

    • Integrate findings with aphid fitness measurements under different thermal regimes

  • Controls and normalization:

    • Include appropriate controls for spontaneous reactions at different temperatures

    • Normalize activity measurements to account for temperature effects on assay components

    • Compare with homologous proteins from organisms adapted to different temperature ranges

How should researchers interpret apparent contradictions between in vitro RnfE function and in vivo observations?

Researchers often encounter contradictions between in vitro biochemical data and in vivo observations when studying proteins from obligate symbionts like Buchnera. Here are methodological approaches to reconcile such discrepancies:

Systematic approach to resolving contradictions:

  • Context-dependent function:

    • Consider that RnfE might function differently in the highly specialized environment of bacteriocytes

    • Evaluate whether the in vitro conditions adequately mimic the in vivo environment (ion concentrations, pH, redox state)

    • Test function under various conditions to identify critical parameters

  • Protein modifications:

    • Investigate potential post-translational modifications that might occur in vivo but not in vitro

    • Examine protein-protein interactions that could modulate activity

    • Consider host factors that might influence protein function

  • Evolutionary considerations:

    • Analyze whether observed discrepancies might reflect adaptation to the symbiotic lifestyle

    • Consider the impact of genome reduction on protein function and regulation

    • Evaluate whether genetic drift due to population bottlenecks (N = 10-20) might have led to suboptimal function

  • Methodological reconciliation:

    • Develop intermediate experimental systems that bridge the gap between in vitro and in vivo

    • Use complementary approaches to validate findings

    • Consider developing Buchnera-derived vesicles that preserve the native membrane environment

What statistical approaches are most appropriate for analyzing the effects of RnfE mutations on protein function and symbiont fitness?

Analyzing the effects of RnfE mutations requires appropriate statistical methods to distinguish genuine functional changes from experimental variation:

Recommended statistical approaches:

  • For biochemical assays:

    • Use multiple technical and biological replicates (minimum n=3)

    • Apply appropriate parametric tests (t-test, ANOVA) for normally distributed data

    • Use non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal distributions

    • Include multiple comparison corrections for testing several mutations

  • For competition experiments:

    • Calculate selection coefficients using the methodology described for Buchnera haplotype competition

    • Use maximum likelihood approaches to estimate selection strength

    • Apply bootstrapping to generate confidence intervals

  • For thermal adaptation studies:

    • Use regression analysis to model temperature-dependent effects

    • Consider reaction norm approaches to characterize thermal performance curves

    • Apply mixed-effects models to account for random variation between biological replicates

  • For symbiont-host fitness correlations:

    • Use path analysis or structural equation modeling to distinguish direct and indirect effects

    • Apply multivariate approaches to capture complex fitness components

    • Consider Bayesian methods for integrating prior knowledge about the system

Sample table format for reporting mutation effects:

MutationPositionConserved in other speciesElectron transfer activity (% of WT)Ion translocation (% of WT)Selection coefficientP-value
K45AMembrane interfaceYes78 ± 545 ± 80.35<0.001
D102NIon channelYes95 ± 312 ± 40.42<0.001
C220SFe-S bindingYes23 ± 725 ± 60.28<0.01

What are the most promising approaches for developing Buchnera-specific genetic manipulation techniques to study RnfE function?

Emerging methodological approaches:

  • Bacteriocyte microinjection techniques:

    • Develop methods to introduce DNA or RNA directly into bacteriocytes

    • Optimize conditions for transfection that don't disrupt the symbiotic relationship

    • Use fluorescent reporters to monitor successful genetic manipulation

  • Host-mediated manipulation:

    • Develop RNAi approaches targeting Buchnera genes that can be delivered through the aphid

    • Engineer aphid bacteriocytes to express modulators of Buchnera protein function

    • Use the aphid's own cellular machinery to deliver CRISPR components

  • Synthetic biology approaches:

    • Create minimal synthetic Buchnera-like systems with engineered RnfE variants

    • Develop cell-free expression systems optimized for Buchnera proteins

    • Design artificial bacteriocyte-like environments for ex vivo studies

  • In situ genome editing:

    • Adapt CRISPR-Cas systems for delivery to intracellular Buchnera

    • Develop phage-based delivery systems that can access intracellular symbionts

    • Explore the potential of mobile genetic elements for gene delivery

  • Evolutionary approaches:

    • Leverage the strong within-host selection (s up to 0.5) to drive experimental evolution

    • Design selection regimes that favor particular RnfE functions

    • Use deep sequencing to track evolutionary trajectories

How might a comprehensive understanding of RnfE function contribute to broader applications in bioenergetics research?

Understanding RnfE function in the context of the Buchnera Rnf complex could have significant implications for bioenergetics research and applications:

Potential applications and contributions:

  • Bioenergetic system engineering:

    • Design minimal, efficient energy-coupling systems for synthetic biology applications

    • Engineer optimized electron transport systems for biotechnological applications

    • Develop specialized ion-pumping systems for targeted applications

  • Evolutionary insights:

    • Better understand the minimal requirements for cellular energy conservation

    • Gain insights into how energy metabolism evolves under extreme genome reduction

    • Identify core bioenergetic principles conserved across diverse organisms

  • Symbiosis research:

    • Elucidate how energy metabolism is adapted to symbiotic lifestyles

    • Understand energy transfer in host-microbe interactions

    • Develop models for metabolic integration between host and symbiont

  • Structural biology advances:

    • Contribute to understanding the structural basis of ion-translocating complexes

    • Identify critical residues and domains involved in energy coupling

    • Advance knowledge of membrane protein structure-function relationships

  • Biotechnological applications:

    • Develop biological systems for energy conversion in resource-limited environments

    • Create bioenergetic modules that can be integrated into artificial cells

    • Engineer systems for ATP production using diverse electron donors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.