Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant FlhB is produced via heterologous expression systems, retaining the full-length sequence (1–383 amino acids) of the native protein from Buchnera aphidicola strain APS . Key attributes include:

PropertyDetail
UniProt IDP57334
Gene LocusBU240
Molecular Weight~43 kDa (predicted)
Storage ConditionsTris-based buffer with 50% glycerol; store at –20°C or –80°C
Sequence FeaturesIncludes conserved domains for type III secretion system (T3SS)

Biological Context in Buchnera aphidicola

Buchnera lacks motility-related genes (e.g., fliC, motAB) but retains 26 flagellar genes, including flhB, organized into five operons . Key findings:

2.1. Gene Expression and Protein Localization

  • Transcription: All 26 flagellar genes, including flhB, are actively transcribed, confirmed via RT-PCR .

  • Translation: Proteomic analyses detected FlhB in whole-cell lysates, alongside other structural proteins (e.g., FliH, FlgF) .

  • Localization: Hundreds of hook-basal-body (HBB) complexes, containing FlhB, densely cover the bacterial surface .

Comparative Genomics

FlhB’s conservation across bacterial species highlights its critical role in secretion systems:

OrganismSequence HomologyFunctional Context
Buchnera aphidicola100% (native)HBB assembly, putative protein transport
Salmonella typhimurium~40%Flagellar biosynthesis, T3SS
Escherichia coli~35%Flagellar regulation

4.1. Proteomic Studies

  • Isolation Protocols: FlhB-enriched membrane fractions were isolated using differential centrifugation and detergent solubilization, confirming its association with basal body complexes .

  • Mass Spectrometry: Spectral counts showed FlhB enrichment (3–5×) compared to whole-cell lysates, validating its structural role .

4.2. Functional Assays

  • ELISA Kits: Recombinant FlhB is commercially available for antibody production and diagnostic applications .

  • Mutational Analysis: Studies using flhB knockouts could clarify its role in symbiosis, though such experiments remain technically challenging due to Buchnera’s unculturable nature .

Implications for Symbiosis Research

The retention of FlhB in Buchnera’s reduced genome underscores its importance beyond motility. Current hypotheses propose:

  • Metabolite Transport: The HBB complex may export amino acids or vitamins to the aphid host .

  • Host-Symbiont Signaling: FlhB-associated T3SS might mediate molecular crosstalk essential for maintaining intracellular symbiosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhB; BU240; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
flhB
Target Protein Sequence
MNHNTNEEKTEHPTEHRIRKFRKKGKTRYSRELSSLFILLVGFINLWWYRDLIVLNFSKI MSDSFLFESNDFLNNNNNLLKILMSLKEILFSFFPFLISLLIVIIIPPILFSGISLNFRS LTLNFSKLNPFHGFKRLFSFQIIVEFFKIILKLFIVSIISFWYLQFSFSEILFLVNANYV SSLSHGYNIIFSCCFLVILGLFPIVFFDIAWQQFNYYKKLKMTRQEMRDELKEKEGNPNI KMRIRQAMKAVMRRRMIINTPKADVIITNPIHYSVALKYDEKNMNAPKVIAKGIGEAAIK IQNLALKHNISIISVPSLARSLYRYSEIGQYIPGPLYKAVAEVLAWVWKVRKWKKEGGIF PEKPINISVPSELTFTGEHETND
Uniprot No.

Target Background

Function
This protein is essential for the formation of the rod structure within the basal body of the flagellar apparatus. In collaboration with FliI and FliH, it potentially constitutes the export apparatus for flagellin.
Database Links

KEGG: buc:BU240

STRING: 107806.BU240

Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of FlhB in Buchnera aphidicola despite the bacterium being nonmotile?

Although Buchnera aphidicola is nonmotile, it maintains flagellar genes including flhB that are actively transcribed and translated. The FlhB protein appears to function as part of the hook-basal-body (HBB) complexes that cover the Buchnera cell surface. Rather than contributing to motility, FlhB likely serves as a component of a protein transport system that is essential for maintaining the symbiotic relationship with the pea aphid host. Hundreds of these HBB complexes have been observed on the cell surface, suggesting an important functional role beyond motility .

What genomic organization patterns do flagellar genes including flhB exhibit in Buchnera aphidicola?

In Buchnera aphidicola, the 26 flagellar genes (including flhB) are arranged in five operons clustered in three genomic regions. Compared to well-studied flagellar systems like that of Salmonella, the order of Buchnera flagellar genes in operons is highly conserved, as evidenced by the alphabetical order of gene alignment. This conservation of gene order suggests preserved transcriptional regulation despite the loss of motility function, indicating selective pressure to maintain these genes for alternative purposes in the symbiotic relationship .

What are the optimal conditions for recombinant expression of Buchnera aphidicola FlhB protein?

For recombinant expression of Buchnera aphidicola FlhB protein, consider the following protocol:

  • Expression system selection: Use E. coli BL21(DE3) strain for expression as it lacks several proteases and provides tight expression control.

  • Vector design: Incorporate a codon-optimized flhB sequence with an N-terminal 6xHis-tag for purification.

  • Growth conditions: Culture at 20°C after IPTG induction to minimize inclusion body formation, as membrane proteins like FlhB often aggregate at higher temperatures.

  • Expression monitoring: Track expression via SDS-PAGE and Western blotting using anti-His antibodies.

Note that the hydrophobic nature of FlhB (as a membrane protein) may require detergent solubilization with mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) for purification .

How can researchers isolate native FlhB protein from Buchnera for comparative studies?

Isolating native FlhB from Buchnera requires addressing the challenges of working with an obligate endosymbiont:

  • Buchnera isolation: Extract Buchnera cells from fresh pea aphids by homogenizing aphid tissue in isolation buffer (50mM Tris-HCl pH 7.5, 25mM KCl, 5mM MgCl₂, 250mM sucrose), followed by filtration and differential centrifugation.

  • Membrane fraction preparation: Lyse Buchnera cells using a French press and separate membrane fractions via ultracentrifugation.

  • FlhB enrichment: Solubilize membrane fractions with appropriate detergents and purify FlhB using immunoaffinity chromatography with anti-FlhB antibodies.

  • Verification: Confirm protein identity via mass spectrometry and Western blotting.

This methodological approach allows for direct comparison between recombinant and native FlhB to validate structural and functional studies .

What techniques are most effective for studying protein-protein interactions involving FlhB in the Buchnera type III secretion system?

Several complementary techniques can be employed to study FlhB protein-protein interactions:

  • Bacterial two-hybrid system: Modified to accommodate membrane proteins like FlhB, this approach can identify potential interaction partners.

  • Co-immunoprecipitation: Using anti-FlhB antibodies to pull down protein complexes from solubilized Buchnera membranes, followed by mass spectrometry identification.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of proteins in their native environment preserves transient interactions for subsequent analysis.

  • FRET/BRET analysis: For studying dynamics of interactions in a heterologous expression system.

  • Surface plasmon resonance: For quantitative measurement of binding affinities between purified FlhB and potential partners.

These approaches can reveal how FlhB interacts with other components of the type III secretion system in this specialized symbiotic context .

How might environmental stress conditions affect FlhB expression and function in the aphid-Buchnera symbiosis?

Environmental stress, particularly heat stress, appears to influence the expression and function of flagellar proteins including FlhB in the aphid-Buchnera symbiosis. Research indicates that mutations affecting stress response (such as the single base deletion in the ibpA promoter) can significantly impact the symbiotic relationship and host thermal tolerance .

A potential experimental approach to study this includes:

  • Differential expression analysis: Compare FlhB expression levels under various stress conditions (temperature, nutrient limitation, oxidative stress) using RT-qPCR.

  • Functional impact assessment: Correlate FlhB expression changes with symbiont density and host fitness measures.

  • Interaction network analysis: Examine how stress alters FlhB interactions with other proteins.

The table below summarizes predicted responses of flagellar genes to environmental stressors based on extrapolation from related systems:

Environmental StressorPredicted FlhB ExpressionPotential Impact on HBB ComplexesHost Fitness Effect
Heat Stress (30°C)DecreasedReduced assemblyNegative
Cold Stress (10°C)IncreasedEnhanced assemblyPotentially positive
Nutrient LimitationMaintained/IncreasedModified functionalityVariable
Oxidative StressVariableStructural modificationsNegative

These predictions require experimental validation, particularly given the specialized context of the aphid-Buchnera symbiosis .

What role might FlhB play in the selective transport of proteins between Buchnera and its aphid host?

Given that Buchnera aphidicola FlhB is part of a structure resembling the type III secretion system apparatus, it likely plays a crucial role in selective protein transport. Research hypotheses include:

  • Substrate specificity: FlhB may function as a gatekeeper, determining which proteins can be transported through the HBB complex.

  • Directional transport: The protein might facilitate bidirectional transport, allowing both import of host nutrients and export of bacterial factors.

  • Regulatory function: FlhB may respond to environmental cues to alter transport priorities.

To test these hypotheses, researchers could:

  • Perform site-directed mutagenesis of key FlhB domains to identify regions critical for function

  • Use fluorescently labeled cargo proteins to track transport in live cells

  • Develop an in vitro reconstitution system to study transport mechanisms

The persistence of flhB in the highly reduced Buchnera genome strongly suggests an essential role in maintaining the symbiotic relationship beyond motility .

How does the evolution of FlhB in Buchnera compare with related proteins in other endosymbionts?

The evolution of FlhB in Buchnera represents a fascinating case of repurposing following the loss of motility. Comparative analysis with other endosymbionts reveals:

  • Selective retention: Unlike many endosymbionts that have lost most or all flagellar genes, Buchnera has selectively maintained components including FlhB.

  • Functional shift: The protein appears to have undergone adaptation for protein transport rather than flagellar assembly.

  • Evolutionary rate: FlhB shows moderate sequence conservation (approximately 40% homology with free-living relatives), suggesting selective pressure to maintain specific functions.

An evolutionary comparison of FlhB across various symbiotic systems would provide insights into convergent evolution in host-microbe interactions. Such studies could employ phylogenetic analyses combined with structural modeling to identify conserved functional domains versus rapidly evolving regions .

What insights might structural studies of recombinant FlhB provide about protein secretion mechanisms in Buchnera?

Structural studies of recombinant FlhB could reveal crucial insights about protein secretion in this specialized symbiotic system:

  • Domain architecture: Crystallographic or cryo-EM studies could identify unique structural features adapted for the symbiotic context.

  • Substrate recognition: Structural analysis of FlhB complexed with potential substrates could reveal binding interfaces and specificity determinants.

  • Conformational changes: Studies of different states of FlhB might reveal how energy coupling occurs during transport.

The structural information could be particularly valuable when compared with FlhB proteins from motile bacteria, potentially revealing adaptations specific to the symbiotic context. Such structural studies require high-purity recombinant protein and could employ techniques including X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy for membrane protein segments .

How can genetic manipulation of flhB be used to study the Buchnera-aphid symbiotic relationship?

While direct genetic manipulation of Buchnera remains challenging due to its obligate endosymbiotic lifestyle, several approaches could be employed to study flhB function:

  • Heterologous expression: Express Buchnera flhB in a related free-living bacterium to assess function.

  • Recombinant protein introduction: Microinject modified recombinant FlhB into bacteriocytes to observe dominant-negative effects.

  • RNA interference: Target flhB mRNA using RNAi delivered to bacteriocytes.

  • Host manipulation: Modify aphid genes that interact with FlhB or its products.

These approaches must account for the specialized ecological context of the symbiosis. The pea aphid (Acyrthosiphon pisum) has emerged as an important genomic model system specifically because it allows controlled experiments on problems directly relevant to symbiotic relationships .

What correlations exist between FlhB functionality and the presence of secondary bacterial symbionts in aphids?

Research suggests complex interactions between primary endosymbionts like Buchnera and secondary facultative symbionts in aphids. While not directly addressed in the search results, we can hypothesize potential relationships:

  • Resource competition: Secondary symbionts may compete for resources, affecting expression of energetically costly systems like the FlhB-containing protein transport apparatus.

  • Functional complementation: Secondary symbionts might provide functions that reduce dependence on certain Buchnera transport processes.

  • Stress modulation: The negative correlation observed between the heat-sensitive Buchnera allele and the presence of facultative symbionts suggests interactions between different symbiont types under stress conditions .

An experimental approach to study these correlations would involve:

  • Comparing FlhB expression and function in aphid lines with and without secondary symbionts

  • Analyzing protein transport efficiency under different symbiont combinations

  • Examining competitive dynamics between symbiont types under various environmental stressors

The observed negative correlation between the heat-sensitive ibpA allele and facultative symbiont presence suggests that studying these interactions could reveal important insights about symbiont complementarity and competition .

What are the key challenges in working with recombinant FlhB from Buchnera and how can they be overcome?

Researchers face several challenges when working with recombinant Buchnera FlhB:

  • Membrane protein expression: As a membrane protein, FlhB tends to aggregate or misfold when overexpressed.

    • Solution: Use specialized expression systems like C41/C43(DE3) E. coli strains designed for membrane proteins, and optimize expression at lower temperatures (16-20°C).

  • Codon usage bias: Buchnera has A+T-rich genome with different codon preferences than expression hosts.

    • Solution: Use codon-optimized synthetic genes designed for the expression host.

  • Functional validation: Confirming proper folding and function of recombinant FlhB is challenging.

    • Solution: Develop activity assays based on protein transport or binding to known partners; compare structural characteristics with predictions.

  • Purification stability: Maintaining stability during purification requires specialized approaches.

    • Solution: Screen multiple detergents and buffer conditions; consider amphipol or nanodisc reconstitution for improved stability .

How should researchers interpret data from FlhB studies in the context of the complete Buchnera flagellar system?

When interpreting experimental data on FlhB, researchers should consider the following contextual factors:

  • System incompleteness: Buchnera lacks several flagellar components present in free-living bacteria, so interpret FlhB function within this reduced system.

  • Evolutionary repurposing: Consider that FlhB may have acquired new functions while retaining structural similarity to homologs in motile bacteria.

  • Host interactions: Always interpret findings in the context of the symbiotic relationship with the aphid host.

  • Experimental limitations: Be aware that in vitro studies may not fully recapitulate the specialized environment of the bacteriocyte.

A holistic approach connecting molecular findings to ecological and evolutionary contexts will provide the most meaningful insights. This includes integrating data from genomic, transcriptomic, proteomic, and functional studies .

What control experiments are essential when studying recombinant FlhB function?

Essential control experiments for recombinant FlhB studies include:

  • Expression validation controls:

    • Negative control: Empty vector expression

    • Positive control: Well-characterized membrane protein expression

    • Western blot analysis with specific antibodies

  • Functional assay controls:

    • Wild-type FlhB from motile bacteria (e.g., E. coli or Salmonella)

    • Site-directed mutants affecting known functional domains

    • Heat-denatured FlhB protein as negative control

  • Interaction studies controls:

    • Pull-down with unrelated proteins to rule out non-specific binding

    • Competition assays with unlabeled putative partners

    • Stepwise truncation constructs to map interaction domains

  • Localization studies controls:

    • Membrane fraction markers

    • Cytoplasmic protein markers

    • Co-localization with known T3SS components

These controls ensure that experimental observations can be reliably attributed to specific properties of the Buchnera FlhB protein rather than experimental artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.