Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola and Endosymbiosis

Buchnera aphidicola is an obligate endosymbiotic bacterium found in aphids, including the pea aphid Acyrthosiphon pisum. Due to its reduced genome size, Buchnera lacks many essential genes required for independent living but maintains a mutualistic relationship with its host, providing nutrients that the aphid cannot synthesize independently . This endosymbiotic relationship has led to significant genomic reduction and specialization, with the bacterial genome retaining only those genes essential for its symbiotic lifestyle.

Among the genes retained in the Buchnera genome are clusters of flagellar genes, despite the fact that these bacteria are nonmotile. Intriguingly, these flagellar gene clusters lack components necessary for motility, such as the flagellin gene, yet they have been preserved through evolutionary time . The conservation of these genes suggests they have acquired alternative functions crucial to the symbiotic relationship.

Evolution of Flagellar Genes in Buchnera

The flagellar assembly pathway in Buchnera aphidicola represents a fascinating example of evolutionary repurposing. The four fully sequenced B. aphidicola genomes retain a large portion of flagellar assembly genes despite the organism's nonmotile nature . This retention is particularly interesting because it suggests functional importance beyond locomotion.

Composition of the Flagellar Apparatus in Buchnera

Microscopic examination has revealed that Buchnera cells are covered with hundreds of hook-basal-body (HBB) complexes distributed across their surface . These structures represent incomplete flagella, containing the hook and basal body components but lacking the filament portion. The abundance of these structures—numbering in the hundreds per cell—strongly suggests they are not vestigial remnants but rather functional components with specific roles in the symbiotic relationship .

Functional Role in Protein Export

While fliP was originally evolved for flagellar assembly and motility in free-living bacteria, its retention in nonmotile Buchnera suggests functional repurposing. Current research indicates that fliP, along with other conserved flagellar proteins, likely functions in protein export .

The most plausible function of the hook-basal-body complexes containing fliP is to serve as protein transporters, facilitating the exchange of proteins between Buchnera and its aphid host . This hypothesis is supported by several observations:

  1. The flagellar apparatus belongs to the family of Type III Secretion Systems (T3SS), which are known to function in protein transport in various bacteria .

  2. The proteins secreted through T3SS lack signal sequences and are secreted without cleavage, making this system ideal for direct protein exchange between symbiont and host .

  3. The abundance of HBB complexes on Buchnera cells (hundreds per cell) suggests a significant role in protein transport rather than a vestigial function .

Sequence Conservation and Divergence

The flagellar genes in Buchnera, including fliP, show interesting patterns of conservation and divergence across different subspecies. While the specific data for Acyrthosiphon pisum subspecies is not directly provided in the search results, we can infer patterns based on comparative studies between other subspecies.

Table 1: Comparative Analysis of Selective Constraints on Flagellar Proteins in Buchnera Subspecies

ProteinFunctionConservation LevelEvolutionary Rate Ratio (R)Significance
FliPCore T3SS componentHighNot specifically providedEssential for protein export
FliMC-ring componentHighLower in endosymbiontsPossible role in sensing protein export levels
FliNC-ring componentHighLower in endosymbiontsForms stable complex with FliM
FliKHook-length controlHighLower in endosymbiontsInvolved in export substrate specificity
FlgEHook proteinHighLower in endosymbiontsStructural component of HBB
FliFMS-ring proteinHighLower in endosymbiontsForms channel for protein export

This table is derived from the comparative analysis described in the research about the evolution of flagellar assembly pathway in endosymbiotic bacteria .

Evolutionary Significance

The patterns of conservation in flagellar proteins, including fliP, suggest differential selective pressures acting on various components of the flagellar apparatus. Some proteins, particularly those involved in protein export and sensing, show lower evolutionary rates in endosymbionts compared to free-living bacteria . This pattern indicates strong purifying selection, suggesting these components have acquired critical functions in the symbiotic relationship.

Expression and Purification

Recombinant Buchnera aphidicola fliP protein can be produced using standard recombinant protein expression systems. Based on commercial offerings for similar proteins, the recombinant fliP is typically produced with specific tags for purification purposes and stored in optimized buffer conditions to maintain stability .

Table 2: Standard Production Parameters for Recombinant fliP Protein

ParameterTypical Specification
Quantity50 μg (other quantities available)
Expression SystemBacterial expression system (specific strain determined during production)
Tag InformationDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for protein stability
Storage Conditions-20°C for standard storage; -80°C for extended storage
Recommended HandlingAvoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

Applications in Research

Recombinant fliP protein has several potential applications in research:

  1. Structural Studies: Understanding the three-dimensional structure of fliP can provide insights into its function in protein export.

  2. Interaction Studies: Investigating interactions between fliP and other components of the flagellar apparatus or potential host proteins.

  3. Antibody Production: Generating specific antibodies against fliP for immunolocalization studies.

  4. Functional Assays: Developing in vitro assays to test the protein export capabilities of fliP and the flagellar apparatus.

  5. Evolutionary Studies: Comparing fliP sequences and structures across different Buchnera subspecies and related bacteria to understand evolutionary patterns.

Evidence for Protein Transport Function

The most compelling hypothesis for the function of fliP and other flagellar proteins in Buchnera is their involvement in protein transport between the symbiont and host. The abundance of HBB complexes on the Buchnera cell surface provides strong circumstantial evidence for this function .

Recent studies have suggested that the flagellar apparatus in Buchnera may represent an evolutionary adaptation where the ancient function of flagella (cell motility) has been replaced by a new function (protein export) . This adaptation is likely governed not only by bacterial evolutionary dynamics but also by host selection pressures.

Implications for Host-Symbiont Interactions

Understanding the role of fliP in protein transport has significant implications for deciphering the molecular mechanisms underlying the Buchnera-aphid symbiosis. If the flagellar apparatus indeed functions as a protein transporter, it would represent a critical component of the symbiotic relationship, facilitating the exchange of essential nutrients and other proteins between the partners .

The specific proteins transported through this system remain to be fully characterized, but they likely include essential amino acids and other nutrients that the aphid cannot synthesize independently. This protein transport system may also be involved in regulating the symbiotic relationship, ensuring that Buchnera populations remain beneficial to the host.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
fliP; BU082; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
fliP
Target Protein Sequence
MKNNLFFQSISNSLHPIFNSEKFLQIMSSLSEIILLILIFSWILKKISSFKINKIISRMK IIERLSVGSQESIILVEVKQLRLLLGVTKKNISHLHTFPSNSKDELIKETNDTLLQKNLF DRSLKNFSKTSWKKTMFYRIIPFVFLLSLCPSAHADMPGLTSHILDDGSQTWSVPVQTLV FLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQILLGLALFLTFFIMSPTFE KIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDLELFSKLAHISSYKNKNDIP MRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPSTISLPFKLMLF VLVDGWQLLITSLAHSFNT
Uniprot No.

Target Background

Function
This protein plays a crucial role in the flagellum-specific transport system.
Database Links

KEGG: buc:BU082

STRING: 107806.BU082

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Buchnera aphidicola and why is it significant for endosymbiont research?

Buchnera aphidicola is the primary obligate intracellular symbiont found in most aphid species. This relationship has been evolving in parallel since their association began approximately 150 million years ago, making it one of the most well-studied models of insect-bacterial endosymbiosis . Buchnera has undergone major genomic and biochemical changes as a result of adapting to intracellular life, including extreme genome reduction while retaining essential functions for the symbiosis . Due to its small genome size, Buchnera lacks many genes necessary for autonomous life but provides essential nutrients to its aphid host in exchange for a protected environment . This system presents an exceptional model for studying the evolution of obligate symbiosis and the minimum genetic requirements for life.

Why do Buchnera cells maintain flagellar genes despite being non-motile?

Buchnera cells are immobile and confined to specialized host-derived "symbiosomal" vesicles inside aphid bacteriocytes, yet they remarkably retain clusters of flagellar genes . While Buchnera lacks the late genes necessary for motility, including the flagellin gene, it has preserved 26 genes that encode proteins for the flagellum basal body structure and flagellum type III export machinery . Research suggests that these flagellar structures have been repurposed during evolution for functions other than motility, most likely serving as type III secretion systems for provisioning peptides or signaling factors to the aphid host . The strong evolutionary conservation of these genes despite massive genome reduction indicates their essential function in maintaining the symbiotic relationship.

What is the specific role of FliP in the Buchnera flagellar system?

FliP is one of the core membrane proteins of the flagellar type III secretion system in Buchnera aphidicola. It forms part of the export apparatus embedded in the cytoplasmic membrane that mediates the selective transport of flagellar proteins from the cytoplasm to the exterior of the cell . In Buchnera, FliP is highly conserved compared to its homologs in free-living bacteria such as Salmonella, with significant sequence homology . As part of the six core proteins of the type III secretion system (T3SS) - along with FlhA, FlhB, FliI, FliQ, and FliR - FliP contributes to the export apparatus that is critical for the assembly and function of the flagellar hook-basal body (HBB) complexes observed on Buchnera cells . Given that Buchnera cells are covered with hundreds of these HBB complexes, FliP likely plays a crucial role in the symbiotic relationship by facilitating protein transport between the bacterium and its host.

How does FliP interact with other flagellar proteins, particularly FliO?

Research with Salmonella enterica has revealed a critical interaction between FliP and FliO. FliO has an important role in maintaining the stability of FliP, which is a highly conserved member of the secretion apparatus . Studies demonstrate that deletion of the fliO gene gives rise to pseudorevertants containing extragenic bypass mutations in FliP at positions R143H or F190L . These mutations appear to compensate for the loss of FliO's stabilizing effect on FliP. Experimental evidence shows that engineered mutants encoding fliP(F190L) mutations in the absence of FliO exhibit restored motility comparable to pseudorevertant strains . This suggests that the interaction between FliO and FliP is crucial for proper assembly and function of the flagellar export apparatus, and that certain mutations in FliP can bypass the need for FliO's stabilizing effect. Similar interactions are likely present in Buchnera's non-motile flagellar system.

What is the predicted membrane topology of FliP in the flagellar export system?

While the search results don't specifically address the membrane topology of FliP in Buchnera, studies on FliO in Salmonella enterica provide insights into the organization of the flagellar export apparatus. FliO has been demonstrated to be a bitopic membrane protein with its N-terminus in the periplasm and C-terminus in the cytoplasm . Given the high conservation of flagellar proteins between Buchnera and other bacteria, FliP likely adopts a similar membrane topology as part of the type III secretion system. Membrane topology prediction and experimental verification using alkaline phosphatase or GFPuv chimeric protein fusions, similar to those used for FliO characterization, would be appropriate methodological approaches to determine the exact topology of FliP in Buchnera . Understanding this topology is crucial for elucidating how FliP functions in the protein export process within the context of the symbiotic relationship.

What experimental approaches can be used to study FliP function in Buchnera aphidicola?

Studying FliP function in Buchnera presents unique challenges due to the obligate endosymbiotic nature of this bacterium. Several approaches have proven effective:

Experimental ApproachApplication to FliP ResearchAdvantagesLimitations
Genetic engineeringCreation of fliP mutants using λ-Red recombinationAllows direct testing of protein functionTechnically challenging in obligate endosymbionts
Fluorescence microscopyVisualization of FliP localization within Buchnera cellsReveals spatial organizationRequires specific antibodies or fluorescent tags
Pseudorevertant analysisIdentification of compensatory mutationsReveals functional interactionsTime-consuming, requires selective pressure
Complementation studiesTesting function of engineered fliP variantsDemonstrates causalityRequires genetic manipulation system
Transcriptome analysisMeasuring expression levels of fliPNon-invasive approachOnly reveals expression, not function

Researchers have successfully employed genetic engineering to create pseudorevertants with enhanced motility after deletion of fliO, revealing compensatory mutations in fliP at positions R143H and F190L . Fluorescence in situ hybridization (FISH) has been effectively used to corroborate the identity and bacteriocyte-specific localization of symbionts in aphids, and could be adapted to study FliP localization . Additionally, transcriptome analyses comparing different aphid lines have revealed variations in expression of flagellar genes, providing insights into their regulation in different symbiotic contexts .

How can recombinant Buchnera FliP be expressed and purified for structural and functional studies?

While the search results don't provide specific protocols for recombinant FliP production from Buchnera, a methodological approach based on general recombinant protein techniques can be outlined:

  • Gene synthesis and optimization: Due to Buchnera's AT-rich genome, codon optimization for expression in E. coli or other common expression systems is advisable .

  • Expression vector selection: Membrane proteins like FliP typically require specialized vectors with appropriate fusion tags (His, GST, MBP) to facilitate purification and enhance solubility.

  • Expression conditions: Testing multiple conditions including:

    • Temperature (16-37°C)

    • Induction methods (IPTG concentration for lac-based systems)

    • Expression host strains (C41/C43 for membrane proteins)

    • Addition of specific detergents or membrane-mimicking systems

  • Purification strategy:

    • Membrane fraction isolation

    • Detergent solubilization screening

    • Affinity chromatography

    • Size exclusion chromatography

  • Functional verification:

    • In vitro reconstitution with other flagellar components

    • Binding assays with interaction partners like FliO

    • Structural analysis by cryo-EM or X-ray crystallography

For structural studies, tag-free protein is often preferred, necessitating protease cleavage sites in the expression construct. Detergent screening is crucial as FliP is a membrane protein and requires appropriate solubilization conditions to maintain native conformation.

What evidence supports the hypothesis that Buchnera's FliP-containing flagellar basal bodies function as protein transport systems?

Multiple lines of evidence support the hypothesis that Buchnera's flagellar basal bodies, which include FliP as a core component, function as protein transport systems rather than motility structures:

  • Structural evidence: Electron microscopy has revealed hundreds of hook-basal-body (HBB) complexes covering the cell surface of Buchnera aphidicola, despite the bacterium being non-motile . These structures lack the filament component necessary for motility but retain the basal body and hook structures.

  • Genomic evidence: The Buchnera genome has retained 26 flagellar genes arranged in five operons clustered in three genomic regions, with highly conserved order compared to motile bacteria like Salmonella . Critically, the six core proteins of the type III secretion system (including FliP) show approximately 40% sequence homology to those of Salmonella, suggesting functional conservation of the export apparatus .

  • Expression evidence: Transcriptome analyses reveal that flagellar genes are actually transcribed and translated in Buchnera, despite the absence of motility . Additionally, different expression patterns of flagellar genes are observed in different aphid lines, suggesting regulatory adaptation to varied symbiotic contexts .

  • Evolutionary evidence: The maintenance of these genes despite extreme genome reduction (Buchnera has only about 600 kbps) strongly suggests an essential function beyond motility . The selective pressure to maintain these genes over 150 million years of co-evolution indicates their importance in the symbiotic relationship .

The abundance of HBB complexes on the Buchnera cell surface strongly suggests they serve as protein transporters not only for flagellar proteins but also for other proteins essential to maintaining the symbiotic system .

How conserved is FliP across different Buchnera strains from various aphid species?

Comprehensive genomic analyses of Buchnera strains from different aphid species reveal interesting evolutionary patterns in the conservation of flagellar proteins, including FliP. The flagellar gene clusters in Buchnera are remarkably conserved across strains, with maintained synteny despite the extensive genome reduction these endosymbionts have undergone . A genomic dataset of 48 Buchnera strains from different aphid species representing 13 different subfamilies shows that core type III secretion system proteins, including FliP, are highly conserved . This conservation contrasts with the substantial gene loss observed in other functional categories, highlighting the essential nature of these proteins for the symbiotic relationship.

Interestingly, in some Buchnera strains, fliO and fliP often occur as fused genes, suggesting a functional adaptation that physically links these interacting proteins . The high level of conservation of FliP across diverse Buchnera strains, despite their divergent evolutionary trajectories in different aphid hosts, provides strong evidence for the critical function of this protein in the symbiotic relationship between Buchnera and aphids.

What can mutation studies of FliP tell us about its critical functional domains?

Mutation studies of FliP provide valuable insights into its critical functional domains and interactions with other components of the flagellar system. Research in Salmonella has identified specific positions in FliP where mutations can compensate for the loss of FliO, namely R143H and F190L . These findings suggest these residues are located in domains critical for proper folding, stability, or function of FliP in the absence of its usual stabilizing partner.

The study of pseudorevertants arising from ΔfliO mutants provides a methodological approach to identifying functionally important domains of FliP . By isolating motile pseudorevertants from non-motile parent strains and sequencing the fliP gene, researchers can identify compensatory mutations. These mutations can then be verified by engineering them into clean genetic backgrounds using λ-Red recombination techniques to confirm their effects .

Further structural and functional studies comparing wild-type FliP with these mutant variants would yield insights into:

  • Protein-protein interaction domains

  • Membrane insertion and topology determinants

  • Critical residues for export function

  • Structural stability determinants

Such information would be valuable not only for understanding the basic biology of type III secretion systems but also for potentially developing tools to manipulate the Buchnera-aphid symbiosis for agricultural applications.

How has the functional role of FliP evolved in Buchnera compared to free-living bacteria?

Several evolutionary adaptations suggest a repurposed function for FliP in Buchnera:

  • Selective gene retention: Despite massive genome reduction (to approximately 600 kbps), Buchnera has selectively retained FliP and other components of the flagellar export apparatus while losing genes for the flagellar filament and motility functions . This selective retention strongly suggests these components serve an essential function beyond motility.

  • Structural adaptations: Buchnera cells are covered with hundreds of hook-basal-body complexes, a density that far exceeds what would be typical for motility purposes in free-living bacteria . This abundance suggests an adapted function possibly related to nutrient or signal exchange with the host.

  • Expression patterns: Differential expression of flagellar genes, including those encoding the export apparatus, has been observed in different aphid lines . For instance, in aphid lines with low Buchnera titers, the endosymbionts show elevated expression of mRNA associated with flagellar secretion genes, including fliP . This differential expression suggests adaptation to varying symbiotic contexts.

The evolutionary trajectory of FliP in Buchnera exemplifies how proteins can be repurposed during the transition to an endosymbiotic lifestyle, maintaining their core biochemical function (protein export) while adapting to serve new biological roles in the context of symbiosis.

How can gene knockout or mutation studies of fliP be designed and executed in Buchnera?

  • Lambda-Red recombination system: This method has been successfully used to generate engineered fliP mutations in Salmonella and could potentially be adapted for Buchnera. The approach involves:

    • Design of targeting constructs with homology to regions flanking the fliP gene

    • Introduction of specific mutations (e.g., R143H or F190L) within the targeting construct

    • Transformation and selection of recombinants

    • Verification by sequencing

  • Pseudorevertant analysis: This indirect approach involves:

    • Creating a deletion in a gene that interacts with fliP (e.g., fliO)

    • Isolating pseudorevertants with restored function

    • Sequencing fliP to identify compensatory mutations

    • Engineering these mutations back into clean genetic backgrounds to verify their effects

  • CRISPR-Cas9 system adaptation: Though challenging in obligate endosymbionts, CRISPR-based approaches could potentially be developed for targeted modification of the fliP gene.

  • RNA interference approaches: For organisms recalcitrant to direct genetic manipulation, RNAi techniques targeting fliP mRNA could provide functional insights without permanent genetic changes.

When designing experiments, researchers should consider the following table of potential mutations and their predicted effects:

Mutation TypeTarget RegionPredicted EffectExperimental Readout
Point mutationsR143 positionAltered stabilityProtein accumulation levels
Point mutationsF190 positionFliO-independent functionExport activity assays
Domain deletionsMembrane-spanning regionsDisrupted membrane insertionLocalization studies
Chimeric constructsVarious domainsIdentify functional regionsComplementation tests

These approaches allow researchers to probe the function of FliP despite the experimental constraints posed by Buchnera's endosymbiotic lifestyle.

What imaging techniques are most effective for visualizing FliP localization and interactions in Buchnera cells?

Several advanced imaging techniques can be employed to visualize FliP localization and interactions within Buchnera cells:

  • Fluorescence in situ hybridization (FISH): This technique has already been successfully used to corroborate the identity and bacteriocyte-specific localization of symbionts in aphids . For FliP-specific localization, FISH could be adapted using:

    • Oligonucleotide probes targeting fliP mRNA

    • Multiple fluorophores for co-localization studies

    • Confocal microscopy for high-resolution imaging

  • Immunofluorescence microscopy: Using antibodies specific to FliP:

    • Primary antibodies against recombinant FliP protein

    • Fluorescently labeled secondary antibodies

    • Super-resolution techniques like STED or STORM for nanometer-scale resolution

  • Electron microscopy approaches:

    • Immunogold labeling for transmission electron microscopy (TEM)

    • Cryo-electron tomography to visualize FliP in the context of intact HBB complexes

    • Correlative light and electron microscopy (CLEM) to combine the advantages of both approaches

  • Protein-protein interaction visualization:

    • Bimolecular fluorescence complementation (BiFC) for direct interaction studies

    • Förster resonance energy transfer (FRET) to detect proximity between FliP and other flagellar components

    • Proximity ligation assay (PLA) for detecting protein interactions with high sensitivity

These techniques can reveal crucial information about FliP's:

  • Spatial distribution in the Buchnera cell membrane

  • Association with other flagellar components

  • Organization within the hook-basal body complexes

  • Dynamic changes under different symbiotic conditions

The hundreds of HBB complexes covering the Buchnera cell surface provide an excellent target for these imaging approaches, allowing researchers to understand how FliP contributes to the structure and function of these protein export machines .

How can the protein transport function of FliP-containing flagellar basal bodies be experimentally assessed?

Assessing the protein transport function of FliP-containing flagellar basal bodies in Buchnera requires innovative experimental approaches. Several methodological strategies can be employed:

  • Reporter protein export assays:

    • Genetic fusion of reporter proteins (e.g., fluorescent proteins or epitope tags) to known flagellar substrates

    • Quantification of reporter protein export from Buchnera cells to the symbiosomal space

    • Comparison of export efficiency between wild-type and fliP mutant strains

  • In vitro reconstitution of the export apparatus:

    • Purification of recombinant FliP and other core components of the flagellar export apparatus

    • Assembly of these components into proteoliposomes or nanodiscs

    • Measurement of substrate protein translocation across these artificial membranes

  • Comparative metabolomics/proteomics:

    • Analysis of the symbiosomal fluid composition in aphids with wild-type versus fliP-mutant Buchnera

    • Identification of differentially abundant proteins or metabolites that may represent export substrates

    • Correlation of these differences with symbiotic phenotypes

  • Transport inhibition studies:

    • Development of specific inhibitors targeting the FliP-containing export apparatus

    • Assessment of the effects on protein transport and symbiotic function

    • Use of temperature-sensitive fliP mutants for conditional inhibition

  • Genetic complementation approaches:

    • Introduction of fliP variants with specific mutations into fliP-deficient Buchnera

    • Assessment of the rescue of protein export function

    • Correlation with restoration of symbiotic phenotypes

These experimental approaches would help elucidate the specific role of FliP in protein transport and the importance of this function for the Buchnera-aphid symbiosis. Given the hundreds of HBB complexes covering the Buchnera cell surface, these structures likely play a critical role in facilitating the exchange of nutrients and signaling molecules that sustain this ancient symbiotic relationship .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.