Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar biosynthetic protein fliR (fliR)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola

Buchnera aphidicola represents an intracellular bacterial symbiont exclusively found within aphids, maintaining a remarkably reduced genome of only about 600 kilobase pairs . This significant genome reduction reflects its obligate symbiotic lifestyle, having evolved to retain primarily genes essential for symbiotic interactions with its aphid host. Buchnera aphidicola subsp. Acyrthosiphon pisum specifically refers to the bacterial symbiont found in the pea aphid Acyrthosiphon pisum, representing one of the most well-studied insect-bacterial symbiotic systems in current research.

The evolutionary trajectory of Buchnera has led to extensive genomic streamlining, with the elimination of genes rendered redundant by functions provided by the host environment. Despite this dramatic reduction, Buchnera has curiously maintained gene clusters coding for flagellum basal body structural proteins and flagellum type III export machinery, including the FliR protein . These structures have been demonstrated to be highly expressed and present in substantial numbers on Buchnera cells, suggesting they serve important functions despite the absence of complete flagellar structures.

The preservation of these flagellar components within such a highly reduced genome provides compelling evidence for their functional importance in the symbiotic relationship. Researchers have hypothesized that these retained flagellar genes may have been repurposed for functions beyond motility, potentially related to specialized protein transport or secretion mechanisms that facilitate symbiotic interactions. This evolutionary conservation presents an intriguing case study in how ancient cellular machinery can be repurposed during the transition to an obligate endosymbiotic lifestyle.

Function of Flagellar Biosynthetic Protein FliR

The flagellar biosynthetic protein FliR serves as an integral component of the flagellar export apparatus across various bacterial species. In well-studied systems like Salmonella typhimurium, FliR is encoded within the fliLMNOPQR operon and plays an essential role in flagellation . Together with FliO, FliP, and FliQ, FliR constitutes part of the membrane-embedded export apparatus required for the transport of flagellar components beyond the cytoplasmic membrane.

In the context of Buchnera aphidicola, the preservation of FliR and other flagellar export apparatus components despite the absence of external flagellar structures presents an evolutionary enigma. Given that Buchnera lacks motility and does not require flagella for movement, the retention of these genes suggests functional repurposing. Current hypotheses propose that these structures might facilitate specialized transport of compounds between the symbiont and host, potentially playing crucial roles in nutritional exchange or signaling processes that maintain the symbiotic relationship.

The isolation of Buchnera flagellum basal body proteins from cellular membranes has confirmed the enrichment of these proteins relative to other proteins in the Buchnera proteome . This enrichment provides further evidence that these proteins form functional complexes within the bacterial membrane, despite not assembling complete flagella. Understanding the precise function of FliR within this context remains an active area of investigation.

Recombinant Production Methods

The production of recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum FliR protein involves sophisticated molecular biology techniques designed to overcome the challenges associated with expressing membrane proteins. Since Buchnera cannot be cultured independently from its aphid host due to its obligate intracellular lifestyle, heterologous expression systems are essential for producing sufficient quantities of the protein for research purposes.

Commercial preparations of this recombinant protein typically utilize Escherichia coli as the expression host . This approach involves cloning the FliR gene into appropriate expression vectors, often incorporating affinity tags to facilitate subsequent purification. While specific tag information for some commercial preparations of Buchnera aphidicola subsp. Acyrthosiphon pisum FliR may vary depending on the production process , related FliR proteins from other organisms frequently employ histidine (His) tags, as observed in recombinant preparations of both Buchnera aphidicola subsp. Baizongia pistaciae and Salmonella typhimurium FliR proteins .

Table 1: Comparison of recombinant FliR protein characteristics from different bacterial species

SpeciesProtein Length (aa)Expression HostCommon TagTypical FormUniProt ID
Buchnera aphidicola subsp. Acyrthosiphon pisum258E. coliVariesSolution in 50% glycerolP57186
Buchnera aphidicola subsp. Baizongia pistaciae257E. coliHisLyophilized powderQ89AZ0
Salmonella typhimurium264E. coliHisLyophilized powderP54702

Following expression, the recombinant proteins undergo purification processes, typically involving affinity chromatography that exploits the incorporated tags. For His-tagged proteins, immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins is commonly employed. The purified proteins are subsequently supplied either in lyophilized form or, more commonly for Buchnera aphidicola subsp. Acyrthosiphon pisum FliR, in solution with appropriate stabilizers such as 50% glycerol .

The successful production of these integral membrane proteins in recombinant form represents a significant technical achievement, considering the inherent challenges associated with expressing, purifying, and maintaining the stability of such hydrophobic proteins while preserving their native structural characteristics.

Research Applications

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum FliR protein has emerged as a valuable research tool for investigating multiple aspects of symbiotic relationships and bacterial membrane transport systems. The availability of this purified protein in recombinant form enables diverse experimental approaches that would otherwise be impossible given the challenges of working with the unculturable Buchnera directly.

A primary application involves structural biology studies aimed at determining the three-dimensional configuration of FliR and its organization within membrane complexes. These investigations can provide critical insights into how flagellar export apparatus components may have been repurposed in obligate symbionts lacking complete flagellar structures. Techniques such as X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy can be employed to elucidate structural details at atomic resolution, though the membrane-embedded nature of FliR presents significant technical challenges.

The recombinant protein also serves as an important reagent for generating specific antibodies, which can subsequently be used for immunolocalization studies to examine the distribution and abundance of FliR within Buchnera cells. Such studies can complement the findings that flagellum basal body proteins are enriched in Buchnera cellular membranes , providing visual evidence of their localization and potentially revealing patterns of spatial organization that might suggest functional associations.

Table 3: Research applications of recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum FliR

Application CategorySpecific TechniquesPotential Research Outcomes
Structural analysisX-ray crystallography, cryo-EM, NMRDetermination of three-dimensional structure and membrane topology
Protein-protein interaction studiesPull-down assays, cross-linking, co-immunoprecipitationIdentification of binding partners within flagellar apparatus or host-derived factors
Antibody productionPolyclonal/monoclonal antibody generationTools for immunolocalization and protein quantification
Membrane reconstitutionLiposome incorporation, nanodiscsFunctional studies in controlled membrane environments
Comparative biochemistrySide-by-side analysis with FliR from other speciesEvolutionary insights into adaptations for symbiosis

Interaction studies represent another significant application, whereby researchers can identify potential binding partners of FliR, including other flagellar proteins or possibly host-derived factors. Techniques such as affinity pull-down assays, chemical cross-linking followed by mass spectrometry, or yeast two-hybrid screening can reveal previously unknown protein-protein interactions that might explain the functional significance of retaining flagellar export apparatus genes in Buchnera's reduced genome.

Comparative biochemical analyses between FliR proteins from different Buchnera subspecies, as well as from other bacterial species like Salmonella typhimurium, can provide evolutionary insights into the conservation and divergence of flagellar export systems. Such comparisons may reveal adaptive changes specific to the symbiotic lifestyle of Buchnera, potentially elucidating how these proteins have been repurposed over evolutionary time.

Evolutionary Significance

The preservation of flagellar biosynthetic protein FliR and other flagellar components in the highly reduced genome of Buchnera aphidicola represents a fascinating evolutionary paradox that offers insights into the selective pressures operating during the transition to obligate endosymbiosis. The retention of these genes, despite substantial genome reduction and the absence of motility requirements, suggests they have acquired essential functions unrelated to their ancestral roles in flagellar assembly.

Comparative genomic analyses across different Buchnera strains reveal that flagellar export apparatus genes, including fliR, have been conserved throughout the evolutionary history of these symbionts. This conservation contrasts sharply with the loss of genes encoding the external portions of the flagellum, indicating differential selective pressures on various components of the flagellar system. The selective retention of the membrane-embedded export apparatus suggests these components have been repurposed for functions essential to the symbiotic relationship.

Several hypotheses have been proposed to explain this evolutionary pattern. One compelling possibility is that the flagellar export apparatus has been adapted to function as a specialized secretion system facilitating the exchange of nutrients or signaling molecules between Buchnera and its aphid host. This repurposing would be consistent with the evolutionary relationship between flagellar systems and type III secretion systems observed in other bacteria, where similar membrane-spanning complexes serve distinct functions.

The enrichment of flagellum basal body proteins in the Buchnera cellular membrane provides empirical support for the continued expression and assembly of these proteins into functional complexes . This observation reinforces the likelihood that these proteins serve important physiological roles rather than persisting as non-functional evolutionary relics.

Understanding the evolutionary trajectory of FliR and related proteins in Buchnera provides valuable insights into the mechanisms of genome reduction in obligate symbionts and the potential for repurposing ancestral cellular machinery for novel functions. This case study illustrates how proteins can maintain their structural integrity while potentially acquiring new functional roles during the transition to an endosymbiotic lifestyle, contributing to our broader understanding of the molecular adaptations underlying intimate host-microbe associations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development according to your specification.
Synonyms
fliR; BU084; Flagellar biosynthetic protein FliR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
fliR
Target Protein Sequence
MLTFNSLQLITLISNFFWPMIRVLSFFSVAPIFKEKLINRKSKILLSGMISWLVWPFLPE VHTVLFSYFGFLLILQQILIGIVLGFTAQLLFATINLSGEIIGLQMGLSFATFFNNNSQI GTSIISRFLNILALFVFITLNMHLYLISIVIDSFYSMPIDGYFLNVNIFFILLKFSSSIF LNGLLLVLPIMIILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVMLPFL KKILDDLIFFMNNNLLHI
Uniprot No.

Target Background

Function
Plays a role in flagellar biosynthesis.
Database Links

KEGG: buc:BU084

STRING: 107806.BU084

Protein Families
FliR/MopE/SpaR family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Buchnera aphidicola and its relationship with aphid hosts?

Buchnera aphidicola is an obligate endosymbiotic bacterium that resides within specialized cells called bacteriocytes in aphids. The relationship between Buchnera and aphids is mutualistic, with Buchnera producing essential amino acids needed by the aphid hosts, enabling these insects to survive on plant sap. This symbiotic relationship is dynamic, with Buchnera titer varying within individual aphids and among different clonal aphid lineages due to environmental and host genetic factors . The pea aphid (Acyrthosiphon pisum) symbiosis with Buchnera represents a model system for studying host-microbe interactions and co-evolution.

What is the function of Flagellar biosynthetic protein fliR in Buchnera aphidicola?

Flagellar biosynthetic protein fliR is a structural component involved in the flagellar assembly system of Buchnera aphidicola. Although Buchnera has lost many genes during its evolutionary adaptation to endosymbiosis, it has retained components of the flagellar apparatus. The fliR protein is part of the flagellar export apparatus and contributes to the Type III secretion system architecture. Research has shown that flagellar proteins, including fliR, can be enriched during isolation procedures, indicating their structural importance in Buchnera . These flagellar components may serve modified functions in the context of host-symbiont interactions beyond traditional motility roles.

How does the amino acid sequence of fliR vary across different Buchnera subspecies?

The amino acid sequences of fliR show variations across different Buchnera subspecies while maintaining key functional domains. Comparing the sequences:

Buchnera SubspeciesUniprot IDLengthKey Sequence Features
Acyrthosiphon pisumP57186258 aaHighly hydrophobic transmembrane regions with conserved LISGMISWLVWPFLPE motif
Schizaphis graminumQ8KA35258 aaVariant hydrophobic regions with ILSFLIAFLIKPFLPK motif
Baizongia pistaciaeQ89AZ0257 aaDistinct N-terminal region (MFQFNFND) compared to others

These sequence variations likely reflect adaptations to different aphid host environments while preserving essential structural functions of the flagellar apparatus .

What are the optimal storage conditions for recombinant fliR protein?

Recombinant fliR protein requires specific storage conditions to maintain stability and activity. The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use. For extended storage periods, conservation at -80°C is recommended. Importantly, repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw damage . These storage recommendations apply across different subspecies of Buchnera aphidicola flagellar proteins.

How can researchers isolate and enrich Buchnera flagellar components for structural studies?

Isolation and enrichment of Buchnera flagellar components requires a specialized protocol:

  • Initial Bacteriocyte Isolation: Carefully dissect aphid bacteriomes containing Buchnera cells.

  • Differential Centrifugation: Apply successive centrifugation steps to separate cellular components.

  • Sequential Enrichment: Perform targeted isolation that substantially enriches structural proteins.

This procedure has been demonstrated to enrich flagellar structural proteins (FliE, FliF, FlgI, FlgE, FlgF, and FlgH) threefold or more from the start to the finish of the isolation process. Other components including FlgB, FlgC, FlgG, FliG, FliH, and FliI are also enriched, though to a lesser extent. The procedure simultaneously depletes abundant non-flagellar proteins such as GroL and Tuf, which are otherwise the most predominant proteins expressed by Buchnera . Mass spectrometry is then used to verify enrichment and characterize the isolated components.

What normalization methods are recommended for quantitative proteomics of Buchnera proteins?

For accurate quantitative proteomics analysis of Buchnera proteins, two complementary normalization methods are recommended:

Both methods should be applied in parallel for robust comparisons, as demonstrated in studies comparing Buchnera protein abundance between different aphid phenotypes. When properly normalized, spectral count analysis can reveal significant changes in Buchnera protein abundance, with demonstrated differences reaching 13-25% between comparative conditions . Applying both normalization strategies provides confidence in the observed biological variations rather than technical artifacts.

How does host genotype influence Buchnera gene expression?

Host genotype significantly influences Buchnera gene expression patterns, demonstrating the complex molecular dialogue between host and symbiont. Research across different aphid lineages has shown that Buchnera titer and gene expression profiles vary in response to the host genetic background. This variation indicates that Buchnera actively contributes to the host-symbiont relationship rather than being a passive participant .

In comparative studies of aphid clones with different Buchnera titers, researchers have observed that:

  • Hosts with low Buchnera titer show different patterns of gene regulation compared to hosts with high Buchnera titer

  • Aphids and Buchnera oppositely regulate genes underlying amino acid biosynthesis and cell growth

  • In high-titer hosts, both bacteriocytes and symbionts elevate expression of genes involved in energy metabolism

These findings reveal that the symbiotic relationship involves coordinated gene expression changes in both partners, likely mediated through molecular crosstalk mechanisms that have evolved over their long association .

What methodologies can detect differential gene expression between Buchnera strains in different aphid lineages?

To detect differential gene expression between Buchnera strains in different aphid lineages, researchers employ several complementary methodologies:

  • RNA-Seq with Ribosomal RNA Depletion:

    • Use QIAseq FastSelect 5S/16S/23S Kit for bacterial rRNA depletion

    • Apply Illumina Ribo-Zero Plus for aphid rRNA depletion

    • Quantify expression using RPKM (Reads Per Kilobase Million) values

  • Quantitative Proteomics:

    • Extract bacteriocytes from different aphid lineages

    • Separate samples into supernatant and pellet fractions

    • Analyze protein abundance through spectral counting

    • Apply dual normalization methods (total aphid spectra and ribosomal protein spectra)

  • Comparative Analysis Framework:

    • Calculate fold changes between Buchnera strains

    • Apply statistical testing with appropriate multiple test corrections

    • Categorize genes by functional groups using Gene Ontology terms

    • Correlate gene expression changes with phenotypic differences

These approaches have successfully identified differential expression patterns in Buchnera from different aphid genetic backgrounds, revealing how symbiont gene regulation adapts to host variation .

How does fliR sequence conservation relate to Buchnera-aphid coevolution?

The fliR sequence conservation pattern provides insights into Buchnera-aphid coevolution at both macro- and microevolutionary scales. Despite genome reduction during the evolution of endosymbiosis, Buchnera has maintained the fliR gene across different aphid host associations. Comparative genomic analyses reveal that:

  • At the macroevolutionary level (between species):

    • fliR sequences show host-specific adaptations that parallel aphid phylogeny

    • Buchnera and their aphid hosts exhibit significant covariance in evolutionary histories

  • At the microevolutionary level (within species):

    • Different strains of Buchnera with variant fliR sequences may coexist within clonal aphid lineages

    • Recent genomic work has identified coexisting Buchnera strains in different clonal lineages of aphids

The conservation of flagellar genes like fliR, despite massive gene loss in these endosymbionts, suggests essential functions beyond motility. The sequence variations observed among subspecies reflect adaptations to different host environments while preserving core functionality . These patterns support the hypothesis that flagellar apparatus proteins have been repurposed for host-symbiont interaction roles during their coevolutionary history.

What evidence exists for "drifting" Buchnera genomes and how does this affect fliR evolution?

Evidence for "drifting" Buchnera genomes comes from microevolutionary studies that track genomic changes across aphid clonal lineages. Recent research examining the genomic variation and covariation in 43 clonal lineages of Myzus persicae found that multiple genetically different strains of Buchnera may coexist as a 'population' within their clonal aphid host . This pattern has also been observed in Russian wheat aphid (Diuraphis noxia) clonal lineages.

The implications for fliR evolution include:

  • Most Buchnera polymorphisms, including those in flagellar genes like fliR, appear to be non-adaptive and likely follow neutral evolutionary trajectories.

  • The microevolutionary patterns suggest that Buchnera genomes largely "drift" with that of their aphid hosts rather than experiencing strong selection pressure.

  • Limited regulatory plasticity in Buchnera means that physiological effects on their aphid host likely come via genetically encoded variants rather than expression changes.

This evidence supports the hypothesis that while host-symbiont coevolution is tight at macroevolutionary scales, at microevolutionary scales much of the genetic variation in Buchnera, including in flagellar genes like fliR, may be effectively neutral . This has important implications for understanding the forces that shape both genome evolution and functional adaptation in this endosymbiotic system.

How can recombinant fliR protein be used to study host-symbiont interface interactions?

Recombinant fliR protein serves as a valuable tool for investigating host-symbiont interface interactions through several advanced experimental approaches:

  • Protein-Protein Interaction Studies:

    • Use purified recombinant fliR as bait in pull-down assays to identify aphid proteins that interact with flagellar components

    • Employ surface plasmon resonance (SPR) or microscale thermophoresis to quantify binding affinities

    • Create domain-specific variants to map interaction regions

  • Immunological Applications:

    • Generate antibodies against recombinant fliR for immunolocalization studies

    • Visualize the distribution of fliR within bacteriocytes using immunofluorescence

    • Track potential relocalization during different developmental stages or stress conditions

  • Functional Assays:

    • Introduce recombinant fliR to aphid cell cultures to observe effects on host cell signaling

    • Assess whether exogenous fliR affects host gene expression patterns

    • Test for potential roles in bacteriocyte formation or maintenance

These applications can reveal whether flagellar proteins like fliR have evolved new functions at the host-symbiont interface, potentially in nutrient exchange, signaling, or maintaining the structural integrity of the symbiotic relationship .

What are the methodological considerations for comparative analysis of fliR proteins across different Buchnera subspecies?

Comparative analysis of fliR proteins across different Buchnera subspecies requires careful methodological considerations:

  • Sequence Alignment Strategy:

    • Use specialized algorithms optimized for membrane proteins

    • Employ position-specific scoring matrices that account for transmembrane domain conservation

    • Consider structural constraints when interpreting sequence divergence

  • Structural Prediction Approaches:

    • Apply multiple modeling methods (homology modeling, ab initio prediction)

    • Validate predictions with experimental data when available

    • Focus on conserved functional domains across subspecies

  • Expression System Selection:

    • Choose expression systems compatible with membrane proteins

    • Optimize codon usage for heterologous expression

    • Consider fusion tags that minimize interference with native structure

  • Functional Characterization:

    • Design assays that can detect subtle functional differences

    • Account for the native bacteriocyte environment in experimental design

    • Develop in vitro systems that mimic the host-symbiont interface

By addressing these methodological considerations, researchers can gain insights into how fliR functional properties may have diverged to accommodate different host environments while maintaining core functionality .

How can researchers correlate fliR sequence variation with functional differences in host-symbiont interactions?

To correlate fliR sequence variation with functional differences in host-symbiont interactions, researchers can implement a multi-layered experimental approach:

  • Site-Directed Mutagenesis Studies:

    • Create variant recombinant fliR proteins with specific amino acid substitutions matching differences observed between subspecies

    • Test these variants in functional assays to identify critical residues

    • Focus on regions showing higher variability across subspecies

  • Domain Swap Experiments:

    • Generate chimeric fliR proteins containing domains from different Buchnera subspecies

    • Assess whether functional properties segregate with specific domains

    • Use these results to map function-specific regions

  • Transcriptome-Proteome Integration:

    • Correlate fliR sequence variations with differences in host and symbiont gene expression patterns

    • Apply RNA-Seq and proteomic analyses to identify downstream effects

    • Look for consistent associations between sequence variants and expression profiles

  • Ecological Context Consideration:

    • Examine whether fliR variants correlate with ecological adaptations of the host aphid

    • Assess performance across different environmental conditions

    • Test whether specific variants confer advantages in particular contexts

This integrated approach can reveal how seemingly subtle sequence variations in fliR might contribute to functional adaptations in different host-symbiont systems, potentially influencing the ecological success of different aphid-Buchnera partnerships .

What statistical approaches are most appropriate for analyzing fliR expression data across different aphid lineages?

When analyzing fliR expression data across different aphid lineages, researchers should implement statistical approaches that account for the unique characteristics of host-symbiont systems:

  • Mixed-Effects Models:

    • Account for nested variation (symbiont within host)

    • Include host genetic background as a random effect

    • Incorporate environmental variables as fixed effects

  • Multiple Test Correction Strategies:

    • Apply FDR (False Discovery Rate) correction when comparing multiple genes

    • Use Bonferroni correction for more conservative hypothesis testing

    • Consider gene set enrichment analysis to identify coordinated expression changes

  • Correlation Analysis Methods:

    • Employ partial correlation to control for host effects

    • Use canonical correlation analysis to relate symbiont and host expression patterns

    • Apply network-based approaches to identify co-expression modules

  • Time Series Considerations:

    • Utilize repeated measures ANOVA for longitudinal studies

    • Apply time series analysis for developmental studies

    • Consider autoregressive models when appropriate

These approaches have successfully identified differential expression patterns in Buchnera from different aphid genetic backgrounds, revealing how symbiont gene regulation adapts to host variation . Properly accounting for the nested nature of variation in these systems is critical for accurate inference.

How can researchers differentiate between adaptive and neutral variations in fliR sequences?

Differentiating between adaptive and neutral variations in fliR sequences requires a multi-faceted analytical approach:

  • Molecular Evolution Tests:

    • Calculate dN/dS ratios (ratio of nonsynonymous to synonymous substitution rates)

    • Apply site-specific models to identify positions under positive selection

    • Conduct McDonald-Kreitman tests comparing polymorphism and divergence

  • Structural-Functional Mapping:

    • Map variations onto predicted protein structures

    • Assess whether variants cluster in functional domains

    • Evaluate conservation in context of protein-protein interaction sites

  • Population Genetic Analyses:

    • Compare sequence diversity within and between aphid host species

    • Test for selective sweeps or balancing selection signatures

    • Assess whether variation patterns follow neutral expectations

  • Experimental Validation:

    • Test functional consequences of naturally occurring variants

    • Compare fitness effects across different ecological contexts

    • Evaluate whether variants correlate with phenotypic differences

Recent research suggests that most Buchnera polymorphisms, including those in flagellar genes like fliR, may be non-adaptive and follow neutral evolutionary trajectories that "drift" with their aphid hosts . This finding highlights the importance of rigorous statistical testing before attributing adaptive significance to observed variations.

What emerging technologies could advance our understanding of fliR function in Buchnera-aphid symbiosis?

Several emerging technologies hold promise for advancing our understanding of fliR function in Buchnera-aphid symbiosis:

  • CRISPR-Based Approaches:

    • Develop symbiont-specific gene editing systems

    • Create conditional knockdowns to assess fliR essentiality

    • Engineer reporter strains to visualize protein localization in vivo

  • Single-Cell Technologies:

    • Apply single-bacteriocyte RNA-Seq to capture heterogeneity

    • Use spatial transcriptomics to map expression patterns within bacteriomes

    • Develop bacteriocyte-specific proteomics approaches

  • Advanced Imaging Techniques:

    • Implement super-resolution microscopy to visualize flagellar structures

    • Use correlative light and electron microscopy to link function with ultrastructure

    • Apply live-cell imaging to track dynamics of host-symbiont interactions

  • Synthetic Biology Approaches:

    • Create minimal flagellar systems to test essential functions

    • Design synthetic circuits to probe signaling pathways

    • Develop host-symbiont interface mimics for in vitro studies

These technologies could help resolve long-standing questions about whether flagellar proteins like fliR have evolved new functions in Buchnera-aphid symbiosis, beyond their ancestral roles in bacterial motility . The integration of these approaches may reveal unexpected roles in nutrient exchange, symbiont inheritance, or host immune evasion.

How might research on fliR contribute to broader understanding of obligate symbiosis evolution?

Research on fliR can contribute significantly to our broader understanding of obligate symbiosis evolution through several conceptual pathways:

  • Repurposing of Ancestral Structures:

    • Flagellar proteins like fliR represent a case study in how ancient bacterial structures may be repurposed for new functions in symbiosis

    • Understanding fliR evolution might reveal general principles about functional shifts during host adaptation

  • Genome Reduction Dynamics:

    • The retention of flagellar genes despite massive genome reduction provides insights into selective pressures during symbiont genome evolution

    • Comparing retention patterns across different symbiotic systems may reveal convergent evolutionary solutions

  • Host-Symbiont Communication Mechanisms:

    • If fliR functions in host-symbiont communication, its study may uncover molecular dialogue mechanisms relevant to other symbioses

    • The evolution of signaling pathways in obligate partnerships may follow predictable patterns

  • Microevolutionary Processes:

    • Understanding whether fliR variations are adaptive or neutral informs broader questions about selection versus drift in symbiont populations

    • The concept of "drifting" Buchnera genomes may apply to other anciently established symbioses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.