Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar M-ring protein (fliF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Buchnera Symbiosis

Despite Buchnera’s loss of motility, FliF is retained as part of a partial flagellar basal body complex. Research highlights its role in:

  • Structural Support: FliF forms the MS-ring, anchoring the basal body to the cytoplasmic membrane .

  • Type III Secretion System (T3SS): The basal body may function analogously to T3SS injectisomes, facilitating protein export to maintain symbiosis .

  • Gene Expression Dynamics: FliF expression correlates with Buchnera population density in aphid hosts, suggesting regulatory coordination with other flagellar genes (fliP, fliQ, fliR) .

3.1. Enrichment and Proteomic Analysis

Isolation protocols for Buchnera basal bodies reveal FliF as a dominant component, enriched ≥3-fold compared to whole-cell lysates . Proteomic data show:

ProteinSpectral Counts (Lysate)Spectral Counts (Enriched)Fold Enrichment
FliF12453.75
FlgI8354.38
FlhA5183.6

This enrichment confirms FliF’s structural stability and abundance in membrane-associated complexes .

3.2. Evolutionary Adaptation

  • Buchnera’s flagellar genes lack motility-related components (fliC, motA/B) but retain T3SS homologs .

  • FliF shares 40–75% sequence homology with Salmonella flagellar proteins, underscoring conservation of core structural motifs .

Applications in Symbiosis Research

Recombinant FliF is utilized to:

  • Study protein-protein interactions in basal body assembly .

  • Develop antibodies for visualizing Buchnera membrane structures .

  • Investigate T3SS-like secretion mechanisms in intracellular symbionts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
fliF; BU073; Flagellar M-ring protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
fliF
Target Protein Sequence
MNFSTIEESVLKEKKKFNNFLSGFLKNSRFLIILLTAAAITAVSISVWIKSPEYQVLYNH LSNEDRGSIINELNEMKIPYQFTDSDGPILVPKDKVYEIRLRLAENNLPRGGSIGFELLD KEKFGISQYNEQINYHRALEGELARTIKKINSVKNARIHIAFSKSSLFLQDKKKSSASII LELQPGRNLNTGQINAIMHLISSSISDLPVENITIVDQSGKLLNQTSVEYDQVNDSQFKY TEEIETRYRNRIKNILEPLVGIGNIYAQVTAQIDFNAQEKTQEKYSPNSDHKNQSIRSHQ IIIHNEIEKSNIQEETPIPLSNSNNHVYFNNNIKNSKNLKNNYIPVDSKINRDNTVNYEL NHSVSHTKMNIGEIKRLSAAVIVNFSKDKNGKFVPLSTQKIKNIEHLIREAIGYSKARGD SVHLVNASFAKYDQKIPVHINHINTFRKSNFLYNFAPWFCSFALLFLLLKKYICPFSKNN TFQNTIPVQEKKSIDTRNIIEKNTFQVDLQNNTNTDKLIHKICNISNQNPRTIALIIRQW MSDKI
Uniprot No.

Target Background

Function

The M ring is likely involved in energy transduction.

Database Links

KEGG: buc:BU073

STRING: 107806.BU073

Protein Families
FliF family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the biological significance of the Flagellar M-ring protein (fliF) in Buchnera aphidicola?

The Flagellar M-ring protein (fliF) in Buchnera aphidicola forms part of the hook-basal-body (HBB) complex found abundantly on the cell surface of this non-motile endosymbiont. Despite Buchnera's lack of motility, the fliF protein serves a critical role as part of a repurposed flagellar structure. Research suggests that these HBB complexes, including the M-ring formed by fliF, have been evolutionarily conserved due to their function in protein transport rather than motility . This protein forms part of the type III secretion system that likely facilitates the exchange of nutrients and signaling molecules between Buchnera and its aphid host, thereby maintaining the obligate symbiotic relationship .

How has the fliF gene been conserved despite Buchnera's extreme genome reduction?

Buchnera aphidicola has undergone substantial genome reduction to approximately 600 kbps, retaining only genes essential to its symbiotic lifestyle . Despite this reduction, Buchnera has maintained 26 flagellar genes arranged in five operons, including fliF . The conservation of these genes amidst widespread gene loss indicates strong selective pressure to maintain these structures. Comparative genomic analyses reveal that flagellar gene clusters show remarkable conservation in gene order across Buchnera strains, though sequence divergence is high . This pattern suggests that the spatial organization of these genes is functionally important, potentially due to co-regulation or assembly requirements of the resulting protein complex.

What genomic evidence indicates the repurposing of fliF in Buchnera's non-motile lifestyle?

Multiple genomic signatures indicate the repurposing of flagellar genes including fliF in Buchnera:

This pattern of gene retention and loss suggests that natural selection has preserved the protein transport function while eliminating components strictly required for motility .

What is known about the expression patterns of fliF in Buchnera aphidicola?

Transcriptomic analyses have demonstrated that flagellar genes in Buchnera, including fliF, are actively transcribed and translated despite the organism's non-motile lifestyle . Interestingly, differential expression of flagellar genes has been observed in aphid lines with varying Buchnera titers. In aphid lines with low Buchnera populations, there is elevated relative expression of mRNA associated with flagellar secretion genes, though specific data for fliF expression patterns are not fully characterized . This suggests that the expression of these genes might be responsive to host conditions or population dynamics, supporting their role in host-symbiont interactions rather than bacterial motility.

How do protein-protein interactions of fliF contribute to the functionality of Buchnera's flagellar apparatus?

The fliF protein forms a critical component of the flagellar basal body by constituting the M-ring, which anchors the structure to the inner membrane. In Buchnera, these interactions appear to be part of an extensive network of protein-protein interactions that maintain the structural integrity of the HBB complex . Experimental approaches including co-immunoprecipitation, pull-down assays, bacterial two-hybrid analysis, and far-western blotting have been employed to characterize these interactions in related systems .

The arrangement of hundreds of HBB complexes on the Buchnera cell surface suggests that fliF interacts not only with other flagellar proteins but potentially with host-derived factors as well . These interactions likely form the molecular basis for the hypothesized protein transport function, enabling the endosymbiont to supply essential nutrients to its aphid host.

How does the co-evolution between Buchnera and aphids affect the molecular evolution of fliF?

Buchnera exhibits significant coevolutionary patterns with its aphid hosts at individual, species, generic, and tribal levels . This tight coevolution has likely influenced the molecular evolution of all Buchnera proteins, including fliF. Phylogenomic analyses reveal high levels of genomic sequence divergence in Buchnera but relative stability in gene order .

The aphid-Buchnera symbiosis is characterized by maternal transmission and population bottlenecks, which contribute to reduced effective population size (Ne) and accelerated sequence evolution . This pattern explains the excess of nonsynonymous polymorphisms observed in Buchnera genes. For fliF specifically, this evolutionary regime may have allowed adaptive changes that optimize its function in the symbiotic context while maintaining structural elements essential for protein transport.

What methodological approaches can determine if fliF participates in nutrient exchange between Buchnera and its host?

To investigate fliF's role in nutrient exchange, several complementary approaches could be employed:

MethodologyApplication to fliF ResearchExpected Outcomes
Recombinant protein expressionProduction of tagged fliF protein for interaction studiesPurified protein for biochemical assays
Pull-down assaysIdentification of interaction partnersDetection of binding to other flagellar proteins or host factors
Fluorescence microscopyLocalization of fliF within bacteriocytesVisualization of protein distribution at host-symbiont interface
Metabolite tracingTracking nutrient movementEvidence of fliF-dependent transport
Mutational analysis in model systemsFunctional characterizationAssessment of transport capabilities with modified fliF

These approaches would provide complementary evidence regarding fliF's participation in the proposed type III secretion system function .

What are the optimal conditions for recombinant expression of Buchnera aphidicola fliF?

Recombinant expression of Buchnera aphidicola fliF presents unique challenges due to the highly specialized nature of this endosymbiont protein. Based on established protocols for similar proteins, the following approach is recommended:

  • Cloning the fliF gene into expression vectors containing 6xHis tags (such as pET28)

  • Expression in E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Induction with 0.1-0.5 mM IPTG at lower temperatures (16-20°C) to promote proper folding

  • Membrane fraction isolation followed by detergent solubilization (typically using mild detergents like DDM or LDAO)

  • Purification via nickel affinity chromatography followed by size exclusion chromatography

This approach has been successful for related flagellar proteins and provides a starting point for fliF isolation . Optimization may be required based on protein-specific characteristics.

How can biophysical techniques be used to characterize fliF structure and function?

Multiple biophysical techniques can provide insights into fliF structure and function:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure content and thermal stability

  • Small-Angle X-ray Scattering (SAXS): For low-resolution structural characterization in solution

  • Cryo-Electron Microscopy: To visualize the M-ring within the larger HBB complex

  • Surface Plasmon Resonance (SPR): To quantify binding kinetics with interaction partners

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding interactions

These techniques would complement the protein-protein interaction studies previously described and provide a more comprehensive understanding of how fliF contributes to the repurposed flagellar structure in Buchnera.

What approaches can verify the assembly of fliF into functional complexes?

Verifying the assembly of fliF into functional complexes requires multiple complementary approaches:

  • Blue Native PAGE: To preserve native protein complexes during electrophoresis

  • Chemical Crosslinking Coupled with Mass Spectrometry: To identify proximity relationships between proteins in the complex

  • Electron Microscopy: To directly visualize the HBB complexes, as demonstrated in previous studies showing hundreds of these structures on the Buchnera cell surface

  • Functional Reconstitution: Attempting to reconstruct minimal functional units in liposomes to assess transport capabilities

These methods would help determine whether recombinant fliF assembles correctly and interacts with appropriate partner proteins to form functional complexes similar to those observed in native Buchnera.

How should researchers interpret evolutionary signatures in fliF sequence data?

When analyzing fliF sequence data across Buchnera strains, researchers should consider several evolutionary patterns that reflect the unique biology of this endosymbiont:

  • The strikingly low sequence diversity in Buchnera (three orders of magnitude lower than in enteric bacteria) reflects maternal transmission and population bottlenecks

  • An excess of nonsynonymous polymorphisms and rare alleles is expected due to reduced effective population size

  • Conservation of gene order despite sequence divergence suggests functional constraints on operon structure

  • Coevolutionary patterns with host aphid lineages may be detected through parallel phylogenetic analyses

Interpretation should account for Buchnera's unusual evolutionary regime, where genetic drift plays a substantial role alongside selection in shaping sequence evolution .

What statistical approaches are appropriate for analyzing protein transport functions of fliF?

Statistical analysis of fliF's potential transport functions should account for the complex nature of host-symbiont interactions:

  • Multivariate analysis: To correlate fliF expression levels with nutrient transport rates across different experimental conditions

  • Bayesian network modeling: To infer causal relationships between flagellar gene expression and metabolic outputs

  • Comparative analysis: To statistically assess differences in transport efficiency between wild-type and modified fliF variants

  • Time-series analysis: To capture dynamic aspects of transport processes

These approaches should be combined with appropriate controls and replication to account for biological variability in this specialized symbiotic system.

How can researchers distinguish between direct and indirect effects of fliF in symbiotic function?

Distinguishing direct from indirect effects of fliF in symbiotic function presents a significant challenge requiring rigorous experimental design:

  • Conditional expression systems: To modulate fliF levels without disrupting other components

  • Domain-specific mutations: To dissect functional regions within the protein

  • Temporal analyses: To establish causal relationships between fliF activity and downstream effects

  • Comparative studies: Analyzing fliF function across different Buchnera strains with varied symbiotic capacities

These approaches can help isolate fliF-specific effects from broader impacts on the flagellar apparatus and symbiotic function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.