Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Multidrug resistance-like ATP-binding protein MdlA (mdlA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MdlA is produced via heterologous expression in E. coli, fused with an N-terminal His tag for purification . It retains the full-length sequence (1-579 amino acids) or partial sequences, depending on the construct . Key features include:

PropertySpecification
Host OrganismBuchnera aphidicola subsp. Acyrthosiphon pisum
Expression SystemE. coli
TagHis tag
Purity≥85% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Gene IDmdlA (synonyms: BU479, bbp_423)
UniProt IDQ89A97 (orthologs vary by subspecies)

Functional Role in Symbiosis

MdlA is an ATP-binding cassette (ABC) transporter implicated in:

  • Multidrug Resistance: Facilitates efflux of toxic compounds via ATP hydrolysis .

  • Amino Acid Transport: Mediates bidirectional exchange of nonessential amino acids (e.g., serine, alanine) between aphid bacteriocytes and Buchnera .

  • Metabolic Complementarity: Enables symbiont-derived cysteine and glycine to support aphid methionine synthesis .

Key Research Findings:

  • Transport Mechanism: Unlike most ABC transporters, MdlA operates via amino acid concentration gradients rather than H⁺-electrochemical gradients .

  • Evolutionary Conservation: Orthologs of MdlA are conserved across Hemipteran insects, underscoring its role in maintaining symbiosis .

  • Genomic Context: Retained in highly reduced Buchnera genomes (400–600 kb), suggesting essentiality despite reductive evolution .

Genomic Features:

SubspeciesGenome Size (bp)mdlA StatusPlasmid Association
Acyrthosiphon pisum~647,000ChromosomalIndependent of trp/leu plasmids
Schizaphis graminum~618,000ChromosomalLinked to metabolic plasmids
Baizongia pistaciae~452,999ChromosomalChimeric pLeu/Trp plasmid

Amino Acid Sequence Highlights:

The full-length MdlA sequence includes conserved ATP-binding motifs (e.g., Walker A/B) and transmembrane domains critical for substrate binding . Notable residues:

  • ATP-Binding Site: Glycine-rich loop (GXXGXGKST) at positions 150–157 .

  • Substrate Specificity: Polar residues (e.g., Tyr-292, Gln-455) mediate interactions with amino acids .

Experimental Use Cases:

  • Drug Resistance Studies: Used to characterize efflux mechanisms in gram-negative bacteria .

  • Symbiosis Modeling: In vitro assays to quantify amino acid flux in aphid-Buchnera systems .

  • Protein Interaction Studies: Co-purified with chaperones like GroEL to assess folding dependencies .

Technical Notes:

  • Reconstitution: Requires sterile water + 5–50% glycerol for long-term storage (-80°C) .

  • Activity Assays: ATPase activity measured via malachite green phosphate detection .

Evolutionary and Ecological Significance

  • Gene Retention: Despite massive gene loss in Buchnera, mdlA persists due to its role in nutrient exchange .

  • Symbiosomal Localization: Immunohistochemistry confirms MdlA’s presence in bacteriocyte membranes, facilitating host-symbiont metabolite exchange .

Comparative Analysis with Other Subspecies

FeatureA. pisum MdlAS. graminum MdlAB. pistaciae MdlA
Sequence Length579 aa580 aa579 aa
Host CompatibilityPea aphidCereal aphidGall-forming aphid
Expression Yield0.1–1.0 mg/mL 0.2–1.2 mg/mL 0.1–0.8 mg/mL

Future Research Directions

  • Structural Resolution: Cryo-EM studies to map substrate-binding pockets .

  • In Vivo Knockdown: Antisense PNA strategies to probe MdlA’s role in symbiosis .

  • Biotechnological Adaptations: Engineering MdlA for bioremediation of antimicrobial agents .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdlA; BU479; Multidrug resistance-like ATP-binding protein MdlA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
mdlA
Target Protein Sequence
MKLFNQLRWFFVREWKRYLGAILLLIIIATLQLLPPKIVGVLIDLIIKKNMHGVQILPWI LIIFLVAVIVYILRYLWRILLFGASYQLATELRVKFYTYLSQQSQIFFLKNRTGDLIARA TNDVDRVVFAAGEGVLTLVDSLVMGFSVLIVMSTQISFLLTIISLIPMPIMAILIKKYGK ELHETFRHAQISFSLLNNQTQEILTSIRMIRAFGLEKNQSNKFNIITRNTGKKNMEVAKI DARFDPVIYLSVAFSNLLAIIGGGWLVWNNQISIGQLTSFIMYLGLMIWPMLALAWMFNI VERGSAAWDRIHSIINKKLYIEDGKNNIPPYPGILNINIKKFYYPNNQKPSLKDIRILIK PGNTLGICGPTGSGKSTLLMLIQRQFNFKKEEIHYHSLSLLEIKIDDWRRRIAVVNQTSF LFSDTISNNISLGKPNASQKEIEEVAKLADVHKDIIDLPERYETQVGERGVMLSGGQKQR VCIARALLLNAEILILDDALSAVDAQTENNILKNINEWKKKKHSLIITTHRLSALINSDE IIVIKSGSIIQRGNHLKLIQEKNWYKSMYYYQQSEIELEDNEKTGEKNL
Uniprot No.

Target Background

Database Links

KEGG: buc:BU479

STRING: 107806.BU479

Protein Families
ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of MdlA in Buchnera aphidicola and why is it significant for research?

MdlA (Multidrug resistance-like ATP-binding protein) in B. aphidicola functions as an ATP-dependent transporter that belongs to the ATP-binding cassette (ABC) transporter family. In other bacteria, these proteins mediate the export of various compounds across cell membranes.

The significance of MdlA in B. aphidicola stems from several factors:

  • It represents one of the few transport systems retained in this highly reduced genome, suggesting essential functionality in the symbiotic relationship

  • Studies of related transporters like MRP1 and MRP2 indicate these proteins function as ATP-dependent export pumps for conjugates and confer resistance to various compounds

  • Understanding MdlA provides insights into nutrient exchange mechanisms between B. aphidicola and its aphid host, which revolves around the synthesis and provisioning of amino acids

Methodologically, research on MdlA offers a window into how obligate endosymbionts maintain essential transport functions despite extreme genome reduction.

How can researchers express and purify recombinant MdlA protein for functional studies?

Expression and purification of recombinant B. aphidicola MdlA requires specialized approaches due to challenges associated with membrane proteins from endosymbionts:

Expression System Selection:

  • E. coli is the preferred heterologous expression system, as demonstrated with similar transporter proteins

  • Recommended strain: BL21(DE3) or derivatives optimized for membrane protein expression

  • Expression vectors should include an N-terminal or C-terminal His-tag for purification via affinity chromatography

Expression Protocol:

  • Transform expression plasmid into selected E. coli strain

  • Culture in LB medium supplemented with appropriate antibiotics

  • Induce expression at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation

  • Enhance expression using histone deacetylase inhibitors (demonstrated to improve expression of similar membrane transporters)

  • Harvest cells and prepare membrane fractions

Purification Strategy:

  • Solubilize membrane fractions with appropriate detergents (e.g., DDM, LDAO)

  • Purify using Ni-NTA affinity chromatography

  • Apply size exclusion chromatography for higher purity

  • Verify protein integrity using SDS-PAGE and Western blotting

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability

Quality Control:

  • Assess protein folding and integrity using circular dichroism

  • Verify ATPase activity using colorimetric phosphate release assays

  • Consider reconstitution into proteoliposomes for functional transport assays

What are the structural and functional differences between MdlA in Buchnera compared to free-living bacteria?

The structural and functional attributes of MdlA in B. aphidicola show adaptations consistent with its endosymbiotic lifestyle:

Structural Characteristics:

  • Full-length MdlA in B. aphidicola subsp. Schizaphis graminum consists of 581 amino acids

  • Domain organization follows the typical ABC transporter architecture with nucleotide-binding domains (NBDs) and transmembrane domains (TMDs)

  • Comparison with free-living bacteria reveals reduced structural complexity while maintaining core functional domains

Functional Adaptations:

  • Computational studies predict reduced protein folding efficiency in Buchnera proteins compared to free-living bacteria, a common feature in obligate endosymbionts

  • Transport substrate specificity may be narrowed to focus on compounds essential for the symbiotic relationship

  • ATP-binding and hydrolysis mechanisms appear conserved, though potentially with altered kinetic properties

Evolutionary Context:

  • The retention of MdlA despite extensive genome reduction (620-650 kb genome) suggests essential functionality

  • Genome analysis indicates B. aphidicola lacks many repair mechanisms and regulatory systems, which may affect MdlA regulation and functional fidelity

These differences have implications for experimental design, as researchers must account for potential instability and altered function when working with the recombinant protein.

How can researchers design experiments to study MdlA function within the context of the aphid-Buchnera symbiotic relationship?

Designing experiments to elucidate MdlA function within the symbiotic context requires integrative approaches:

In Vivo Approaches:

  • Gene Expression Manipulation:

    • Apply recently developed peptide nucleic acid (PNA) technology for gene knockdown

    • Design antisense PNAs conjugated to cell-penetrating peptides targeting mdlA

    • Microinject PNAs into bacteriocytes and monitor effects on:

      • Buchnera density and morphology

      • Amino acid transfer between symbiont and host

      • Aphid fitness parameters

  • Comparative Expression Studies:

    • Implement qRT-PCR to quantify mdlA expression under varied nutritional conditions

    • Design experiments following established protocols for analyzing Buchnera transcriptional responses to dietary changes

    • Use full-genome microarrays based on sequenced genomes of Buchnera strains

Experimental Design Considerations:

  • Apply fundamental principles of experimental design including randomization, replication, and blocking

  • For dietary manipulation studies, consider reversal designs (e.g., A₁B₁A₂B₂) where:

    • A represents control diet

    • B represents experimental diet with altered amino acid composition

  • Include multiple biological replicates (n≥5 per condition) to account for variation

Data Analysis Strategy:

  • Apply mixed-effects linear models that incorporate experimental design factors

  • Analyze mdlA expression data in context with other transport-related genes

  • Correlate molecular findings with physiological responses at both symbiont and host levels

This integrated approach allows for establishing causal relationships between MdlA function and symbiotic processes.

What techniques can be used to investigate the substrate specificity and transport kinetics of recombinant MdlA?

Investigating substrate specificity and transport kinetics of MdlA requires specialized techniques for membrane transporters:

Substrate Specificity Determination:

  • Vesicle Transport Assays:

    • Reconstitute purified MdlA into proteoliposomes

    • Use inside-out membrane vesicles to measure ATP-dependent transport

    • Test potential substrates including:

      • Amino acids and their conjugates

      • Metabolic intermediates in amino acid biosynthesis

      • Antimicrobial compounds

  • ATPase Activity Coupling:

    • Measure stimulation of ATPase activity in presence of transport substrates

    • Determine substrate concentration dependencies to calculate affinity constants

    • Compare with known kinetic parameters from related transporters:

    TransporterSubstrateKm Value (μM)Reference
    Human MRP2Leukotriene C41.0 ± 0.1
    Human MRP1Leukotriene C40.1 ± 0.02
    Human MRP217β-glucuronosyl estradiol7.2 ± 0.7
    Human MRP117β-glucuronosyl estradiol1.5 ± 0.3

Transport Kinetics Characterization:

  • Electrophysiological Approaches:

    • Patch-clamp techniques to measure transporter-associated currents

    • Whole-cell recordings to determine transport rates under various conditions

  • Fluorescence-Based Transport Assays:

    • Utilize fluorescent substrate analogs to monitor real-time transport

    • Apply stopped-flow techniques to determine initial transport rates

    • Calculate kinetic parameters (Vmax, Km) under different conditions

Computational Approaches:

  • Homology modeling based on crystallized ABC transporters

  • Molecular docking to predict substrate binding modes

  • Molecular dynamics simulations to examine transport mechanisms

These techniques will provide insights into MdlA's functional role in the nutrient exchange that underpins the aphid-Buchnera symbiosis.

How does the genetic variation in mdlA across different Buchnera strains correlate with aphid host adaptation?

Analyzing genetic variation in mdlA across Buchnera strains provides insights into co-evolutionary dynamics with aphid hosts:

Comparative Genomic Approaches:

Host-Symbiont Co-evolution Analysis:

  • Genetic distance between pairs of Buchnera samples positively correlates with genetic distance between their aphid hosts

  • Construct phylogenetic trees for both mdlA sequences and corresponding host mitochondrial markers

Functional Implications Assessment:

  • Analyze non-synonymous vs. synonymous substitution rates (dN/dS) in mdlA across strains

  • Recent studies suggest abundance patterns of non-synonymous mutations in Buchnera are similar to synonymous mutations, indicating neutral evolutionary processes

  • Correlate specific mdlA variants with:

    • Host plant specialization

    • Geographic distribution

    • Climatic adaptation patterns

Experimental Validation:

  • Express variant forms of mdlA and test functional differences in transport assays

  • Utilize heterologous complementation in transporter-deficient bacterial strains

This integrative approach will reveal how mdlA diversity contributes to the ecological success of different aphid lineages.

How can researchers quantify the impact of mdlA expression levels on Buchnera density and function within bacteriocytes?

Quantifying the relationship between mdlA expression and Buchnera density requires integrated molecular and cellular approaches:

Experimental Design:

  • Manipulating mdlA Expression:

    • Apply antisense PNA technology to achieve graded knockdown of mdlA

    • Design a dose-response experiment with increasing concentrations of anti-mdlA PNAs

    • Include appropriate controls including non-targeting PNAs and untreated samples

  • Buchnera Density Quantification:

    • Implement mass spectrometry analysis of proteome without prior extraction

    • This approach is recommended over qPCR or cytometry due to variable chromosome copy numbers in Buchnera cells

    • Calculate the relative Buchnera spectra versus total aphid host spectra as index of endosymbiont density

Analytical Framework:

Correlation Analysis:

  • Measure mdlA expression levels using qRT-PCR

  • Quantify Buchnera cell density using proteomics approaches

  • Assess bacteriocyte morphology and number using confocal microscopy

  • Apply statistical modeling to determine the relationship between expression levels and bacterial density

Phenotypic Assessment:

  • Monitor aphid fitness parameters including:

    • Growth rate

    • Reproduction capacity

    • Nutrient status (especially amino acid profiles)

  • Test adaptation to environmental stressors with varying mdlA expression levels

This approach provides a comprehensive understanding of how mdlA expression influences the symbiotic relationship at cellular and organismal levels.

What are the mechanisms of regulation for mdlA expression in Buchnera given its reduced genome and limited transcriptional regulatory genes?

Understanding mdlA regulation in Buchnera presents a unique challenge due to genome reduction and loss of regulatory elements:

Current Understanding of Transcriptional Regulation in Buchnera:

  • Buchnera has undergone extensive reduction of regulatory systems

  • Regulatory elements lost include:

    • Regulatory genes

    • Promoter elements

    • Shine-Dalgarno sequences

    • Transcription attenuators

    • DnaA boxes

  • Transcriptomic studies show Buchnera gene expression changes are confined to a narrow range under environmental variations

Alternative Regulatory Mechanisms:

  • Host-Mediated Regulation:

    • The mTOR pathway in aphids may regulate symbiont function through expression of amino acid transporters

    • Aphid genes related to amino acid transporters show tissue-specific expression and colocalize with Buchnera in embryos

    • The arginine, glutamine, and asparagine transporter SLC38A9 is among the most highly expressed amino acid transporters in aphid symbiotic tissue

  • Post-transcriptional Regulation:

    • Despite limited transcriptional control, Buchnera may employ RNA-based regulation

    • Analyze small non-coding RNAs that might function in post-transcriptional regulation

    • Investigate RNA stability as a regulatory mechanism

  • Metabolic Feedback:

    • Substrate availability may directly influence transporter activity without transcriptional changes

    • ATP levels could regulate MdlA function through allosteric interactions

Experimental Approaches:

  • Compare mdlA expression under various nutrient conditions using qRT-PCR

  • Design microarray experiments to detect subtle expression changes in response to host signals

  • Apply ribosome profiling to investigate translational regulation

  • Use metabolomic approaches to correlate metabolite levels with MdlA activity

Systems-Level Regulation:

These insights provide a framework for understanding how mdlA expression is controlled within the constraints of Buchnera's reduced regulatory capacity.

How can researchers distinguish between the transport functions of MdlA and other transporters in the Buchnera membrane system?

Distinguishing the specific functions of MdlA from other transporters requires targeted approaches that overcome the technical challenges of working with unculturable endosymbionts:

Comprehensive Transporter Profiling:

  • Genomic Context Analysis:

    • Catalog all predicted transporters in the Buchnera genome

    • Recent genomic studies have identified between 553-585 protein-coding genes in various Buchnera strains

    • Create a functional classification of transporters based on predicted substrate specificity

  • Expression Pattern Analysis:

    • Implement qRT-PCR to compare expression levels of different transporters

    • Design experiments to test differential expression under varied nutritional conditions

    • Create co-expression networks to identify functionally related transport systems

Functional Discrimination Approaches:

  • Selective Inhibition:

    • Identify selective inhibitors for different transporter classes

    • For ABC transporters like MdlA, use ATP analogs or specific inhibitors

    • Measure transport activity in the presence of inhibitors to determine contribution of each transporter type

  • Substrate Competition Assays:

    • Design competition experiments using known substrates for different transporters

    • Measure transport kinetics in the presence of competing substrates

    • Calculate inhibition constants to determine transporter specificity

Genetic Approaches:

  • Targeted Gene Knockdown:

    • Apply antisense PNA technology for selective knockdown of mdlA

    • Design a panel of PNAs targeting different transporters

    • Compare phenotypic effects to delineate specific functions

  • Heterologous Expression:

    • Express individual Buchnera transporters in model bacteria lacking endogenous transporters

    • Perform transport assays in these defined systems

    • Compare transport properties to identify unique functions of MdlA

Integrative Analysis:

These approaches allow researchers to define the specific role of MdlA within the context of Buchnera's limited but essential transport systems.

What are the implications of ATP-dependent transport mechanisms for energy metabolism in the Buchnera-aphid symbiotic system?

The energetic implications of ATP-dependent transporters like MdlA are crucial for understanding the metabolic integration in this obligate symbiosis:

Energetic Constraints in the Symbiotic System:

  • Buchnera has limited metabolic capacity due to genome reduction (620-650 kb)

  • ATP-binding cassette (ABC) transporters require ATP hydrolysis for substrate translocation

  • Energy allocation for transport vs. biosynthetic functions represents a critical metabolic trade-off

ATP Budget Analysis:

  • Energy Sources:

    • Buchnera must generate ATP through central carbon metabolism

    • Phosphate and carbon sources must be imported from the host

    • ATP generation capacity is limited by retained metabolic pathways

  • Energy Expenditure:

    • ATP-consuming processes include:

      • Amino acid biosynthesis (primary symbiotic function)

      • Protein synthesis

      • DNA replication

      • Cell maintenance

      • Transport via ABC transporters like MdlA

Metabolic Integration:

  • Transport processes mediated by MdlA may be synchronized with aphid feeding cycles

  • Host-derived signals could regulate ABC transporter activity to optimize energy utilization

  • ATP:ADP ratios may serve as metabolic feedback signals

Experimental Approaches:

  • Metabolic Flux Analysis:

    • Trace carbon and phosphate flow through the symbiotic system using stable isotopes

    • Quantify ATP production and consumption rates

    • Determine the proportion of energy budget allocated to MdlA function

  • Transport Energetics:

    • Measure ATP consumption during substrate transport

    • Determine coupling efficiency (ATP hydrolyzed per substrate transported)

    • Compare energetic efficiency of MdlA with other bacterial transporters

    Transport SystemATP Consumption RateCoupling EfficiencyNotes
    MdlA (predicted)MediumMedium-LowBased on similar ABC transporters
    Phosphate ABC transportersHighMediumEssential for energy metabolism
    Amino acid transportersVariableMedium-HighCritical for symbiotic function

Evolutionary Perspective:

  • Retention of ATP-dependent transporters despite genome reduction suggests essential functionality

  • Energy investment in MdlA transport indicates critical role in symbiotic homeostasis

  • Trade-offs between transport efficiency and specificity may have shaped MdlA evolution

Understanding these energetic implications provides insight into the metabolic integration that has evolved in this ancient symbiotic relationship.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.