Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to NADH-Quinone Oxidoreductase Subunit K (nuoK)

The recombinant NADH-quinone oxidoreductase subunit K (nuoK) from Buchnera aphidicola subsp. Acyrthosiphon pisum is a hydrophobic membrane protein critical to the bacterial NADH dehydrogenase I (NDH-1) complex. This enzyme catalyzes electron transfer from NADH to quinones while translocating protons across the cytoplasmic membrane, contributing to ATP synthesis in the respiratory chain . The recombinant form is produced in E. coli with an N-terminal His tag for purification and structural studies .

2.2. Key Functional Residues

Critical residues identified in structural and mutational studies include:

ResiduePositionRoleImpact of Mutation
Glu-36TM2Proton translocation and electron coupling Complete loss of activity (Ala substitution)
Glu-72TM3Modulates proton pumping efficiency Moderate activity reduction (Ala substitution)
Arg-25/26Cytosolic loopStabilizes proton-pumping pathway Drastic reduction in proton translocation

These residues are conserved across bacterial NDH-1 complexes and mitochondrial ND4L homologs .

3.1. Expression and Purification

  • Host Organism: E. coli

  • Tag: N-terminal His tag for affinity chromatography

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

3.2. Stability and Handling

  • Reconstitution: Use deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage

  • Avoid: Repeated freeze-thaw cycles

4.2. Symbiotic and Ecological Insights

  • Aphid Symbiosis: Buchnera’s nuoK is critical for ATP production in aphids, supporting their dependence on this endosymbiont for essential amino acids .

  • Immune Evasion: Gene duplication in aphids may involve nuoK-related pathways, though direct evidence remains limited .

Comparative Insights with Homologs

OrganismSubunitKey Differences
E. coliNuoKIdentical role in NDH-1; conserved Glu residues
MitochondriaND4LHomologous structure; retained proton-translocation function
Thermus thermophilusNQO6Shared inhibitor-binding sites (e.g., for rotenone analogs)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
nuoK; BUAP5A_161; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Target Names
nuoK
Target Protein Sequence
MISLFHGLFLSLILFILGLTSLIVRRNILFILISLEIMMNAVGLALIVVGSYWHQADGQI MYIFVITLAASEASIALALLLQLYRRKKTLNIDILSEMNG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what role does it play in aphid biology?

Buchnera aphidicola is a gamma-proteobacterium that functions as an obligate endosymbiont in aphids. Most aphid species rely on this single bacterial endosymbiont to supply them with essential nutrients lacking in their phloem-sap diet. The symbiotic relationship between aphids and Buchnera is mutualistic, with the bacterium residing in specialized cells called bacteriocytes within the aphid host. To study this relationship, researchers typically employ metagenomic approaches combined with fluorescent in situ hybridization microscopy to visualize the localization of the bacteria within host tissues. The evolutionary significance of this relationship is evident from the metabolic interdependencies that have developed, where genome reduction in Buchnera has led to reliance on the host for certain metabolic functions, while the bacterium provides essential nutrients to the host .

What is the functional significance of NADH-quinone oxidoreductase subunit K in Buchnera aphidicola?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase (Complex I) in the respiratory chain of Buchnera aphidicola. This complex plays a crucial role in energy metabolism by coupling electron transfer from NADH to quinone with proton translocation across the membrane. The methodology to study this function typically involves isolation of the protein complex followed by biochemical assays to measure electron transfer rates and proton translocation efficiency. In experimental settings, researchers can use recombinant nuoK to reconstitute partial or complete NADH dehydrogenase complexes and assess their functionality. The conservation of this subunit across different Buchnera lineages suggests its essential role in maintaining the energetic balance necessary for the symbiotic relationship with aphids .

How can researchers differentiate between Buchnera aphidicola symbiont strains in experimental settings?

Researchers can differentiate between Buchnera aphidicola symbiont strains using a combination of molecular and genomic approaches:

MethodApplicationResolution LevelData Output
16S rRNA sequencingTaxonomic identificationGenus/species levelSequence data for phylogeny
Whole genome sequencingComprehensive genome analysisStrain-specific differencesComplete genomic information
Metagenomic analysisCommunity compositionMulti-species resolutionRelative abundance data
FISH microscopySpatial localizationCell/tissue levelVisual confirmation of localization

When designing experiments to differentiate between strains, researchers should employ a multi-faceted approach that combines these techniques. For instance, initial screening with 16S rRNA amplicon sequencing can be used on 223 aphid samples (147 species from 12 subfamilies) to establish basic taxonomic identities, followed by whole genome sequencing on selected samples to resolve strain-specific differences . Fluorescent in situ hybridization microscopy should then be used to confirm the localization of symbionts within bacteriocytes, which helps distinguish between obligate and facultative symbionts based on their cellular compartmentalization.

What experimental designs are optimal for studying the metabolic contribution of nuoK in the Buchnera-aphid symbiosis?

When investigating the metabolic contribution of NADH-quinone oxidoreductase subunit K (nuoK) in the Buchnera-aphid symbiosis, researchers should consider implementing experimental designs that allow for causal inference. A classic experimental design with randomization, control groups, and pre/post measurements would be ideal but faces practical challenges due to the obligate nature of the symbiosis.

The Solomon 4-Group Design represents an effective approach for this research:

GroupPretestTreatmentPosttest
Experimental 1 (R)O1X (genetic modification of nuoK)O2
Control 1 (R)O3-O4
Experimental 2 (R)-X (genetic modification of nuoK)O5
Control 2 (R)--O6

In this design, "R" denotes random assignment, "O" denotes observation/measurement, and "X" denotes the experimental treatment (which could be genetic modification of nuoK expression) . The inclusion of both pretested and non-pretested groups allows researchers to control for potential testing effects.

For studying nuoK specifically, methodology should include:

  • Genetic manipulation techniques: CRISPR-Cas9 for targeted modification of nuoK expression

  • Metabolic flux analysis: Isotope labeling to track nutrient exchange between Buchnera and host

  • Respirometry measurements: To quantify changes in respiratory chain activity

  • Transcriptomics and proteomics: To assess compensatory changes in expression patterns

When implementing this design, researchers must account for the challenge that Buchnera cannot be cultured outside its host, necessitating in vivo approaches or sophisticated ex vivo systems that maintain bacteriocyte integrity .

How does genome reduction in Buchnera aphidicola affect the expression and function of respiratory chain components like nuoK?

Genome reduction in Buchnera aphidicola represents an evolutionary consequence of its endosymbiotic lifestyle, with significant implications for respiratory chain components including NADH-quinone oxidoreductase subunit K (nuoK). Research methodologies to investigate this relationship require integrated genomic and functional approaches.

Studies show that despite extreme genome reduction, Buchnera strains retain complete or near-complete respiratory chain complexes, suggesting strong selective pressure to maintain these functions. The methodological approach to studying this phenomenon involves comparative genomics across multiple Buchnera strains, combined with functional assays of respiratory activity.

Genome-based metabolic inference reveals that small losses affecting key genes can be the onset of dual symbiotic systems, where Buchnera is complemented by secondary symbionts . Analysis of genome evolution patterns across Buchnera lineages demonstrates that while large gene losses can occur without acquisition of co-obligate symbionts, the loss of even a few key genes in metabolic pathways can necessitate complementation by secondary symbionts.

To experimentally investigate how genome reduction affects nuoK function specifically, researchers should:

  • Conduct comparative analysis of nuoK sequence conservation across Buchnera strains with different genome sizes

  • Measure expression levels of nuoK relative to other respiratory chain components

  • Assess functionality of recombinant nuoK from different Buchnera strains through enzyme activity assays

  • Map metabolic networks to identify compensatory pathways that may emerge in response to constraints in respiratory chain function

This research is particularly relevant given that NADH-quinone oxidoreductase plays a crucial role in energy metabolism, and changes in its function could significantly impact the symbiont's ability to provide nutrients to its host.

What are the challenges in expressing and purifying recombinant Buchnera aphidicola proteins, and how can they be overcome?

Expression and purification of recombinant Buchnera aphidicola proteins, including NADH-quinone oxidoreductase subunit K (nuoK), present several technical challenges due to the organism's specialized evolutionary adaptations as an endosymbiont. These challenges and their methodological solutions include:

ChallengeMethodological ApproachOptimization Parameters
Codon usage biasCodon optimization for expression hostAdaptation index >0.8
Protein toxicity to hostInducible expression systemsIPTG concentration 0.1-0.5 mM
Membrane protein solubilityDetergent screeningn-Dodecyl β-D-maltoside (DDM) at 1-2%
Protein misfoldingChaperone co-expressionGroEL/GroES, DnaK/DnaJ/GrpE systems
Low expression yieldsFusion tags (MBP, SUMO)N-terminal positioning preferred
Purification challengesAffinity chromatography combinationsIMAC followed by size exclusion

For NADH-quinone oxidoreductase subunit K specifically, researchers should consider:

  • Using specialized expression systems for membrane proteins, such as C41(DE3) or C43(DE3) E. coli strains

  • Implementing a mild solubilization protocol using DDM or digitonin to maintain protein-protein interactions within the complex

  • Employing Blue Native PAGE to assess complex integrity following purification

  • Utilizing liposome reconstitution to evaluate functional activity

Commercial sources of recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum NADH-quinone oxidoreductase subunit K are available , but for research requiring custom modifications or higher purity, optimized laboratory expression protocols are preferable. When designing expression constructs, researchers should carefully consider the impact of purification tags on protein folding and function, particularly for membrane-embedded subunits like nuoK.

How do co-obligate symbioses influence the metabolic interdependencies involving NADH-quinone oxidoreductase in different aphid lineages?

The evolution of co-obligate symbioses across aphid lineages has profound implications for the metabolic interdependencies involving respiratory chain components like NADH-quinone oxidoreductase. Research methodologies to investigate these complex relationships require integrated approaches across genomics, metabolism, and evolutionary biology.

Recent studies have demonstrated that dual symbioses have evolved anew at least six times across aphid lineages, with secondary co-obligate symbionts typically evolving from facultative symbiotic taxa . The methodological approach to studying these systems involves:

  • Comparative genomics: Metagenomics on multiple aphid species (25 species from nine subfamilies) combined with re-assembly and re-annotation of previously sequenced symbionts

  • Metabolic reconstruction: Genome-based inference of metabolic pathways to identify interdependencies between Buchnera and secondary symbionts

  • Visualization techniques: Fluorescent in situ hybridization microscopy to confirm symbiont localization

  • Evolutionary analysis: Phylogenetic methods to trace the emergence of co-obligate relationships

The metabolic interdependencies between symbionts can be mapped through computational pathway analysis, revealing complementary functions in nutrient synthesis. For NADH-quinone oxidoreductase specifically, researchers should investigate whether secondary symbionts complement or replace components of this complex when Buchnera has lost related genes.

A systematic experimental approach should:

  • Compare nuoK sequence and expression across single-symbiont and co-obligate symbiont systems

  • Quantify respiratory chain activity in both types of symbiotic relationships

  • Trace metabolic flux through central carbon metabolism to identify differences in energy generation strategies

  • Measure host fitness parameters to correlate with observed metabolic differences

These investigations would reveal how evolutionary processes have shaped energy metabolism in these intricate symbiotic systems, providing insights into the functional role of NADH-quinone oxidoreductase in maintaining these relationships.

What systems biology approaches can be applied to study the role of nuoK in Buchnera-aphid metabolic networks?

Systems biology offers powerful approaches to understand the complex role of NADH-quinone oxidoreductase subunit K (nuoK) within the broader context of Buchnera-aphid metabolic networks. The methodology involves integrating multiple data types and analytical frameworks:

  • Multi-omics data integration: Combine genomics, transcriptomics, proteomics, and metabolomics data to create comprehensive models of metabolic networks. This approach allows researchers to trace how perturbations in nuoK expression propagate through the system.

  • Network inference techniques: Apply computational methods such as ARACNE (Algorithm for the Reconstruction of Accurate Cellular Networks) to identify potential regulators of metabolic pathways involving nuoK . This approach can reveal previously unknown regulatory relationships.

  • Genome-scale metabolic modeling: Construct in silico models that simulate metabolic flux through the Buchnera-aphid system, with specific attention to energy-generating pathways involving NADH-quinone oxidoreductase.

  • Perturbation experiments with systems-level readouts: Design experiments that manipulate nuoK expression or function while measuring global responses across multiple biological levels.

When designing these studies, researchers should consider:

Data TypeAnalytical MethodExpected Outcome
TranscriptomicsDifferential expression analysisIdentify co-regulated genes with nuoK
ProteomicsProtein-protein interaction networksMap physical interactions of nuoK with other proteins
MetabolomicsFlux balance analysisQuantify metabolic consequences of nuoK perturbation
GenomicsComparative genomics across symbiontsEvolutionary context of nuoK function

A comprehensive systems biology investigation would include analysis of how the aerobic and anaerobic metabolic pathways are coordinated in response to environmental stressors . This is particularly relevant as studies in related systems have shown that exposure to mild acidic conditions can trigger significant transcriptional reorganization of metabolic genes, including those involved in respiratory processes.

How can network inference techniques be applied to identify regulators of respiratory chain components in Buchnera aphidicola?

Network inference techniques provide powerful tools for identifying potential regulators of respiratory chain components, including NADH-quinone oxidoreductase subunit K, in Buchnera aphidicola. These computational approaches are particularly valuable given the experimental challenges of working with obligate endosymbionts.

The methodological approach involves:

  • Data generation and preprocessing:

    • Generate time-course gene expression data under various conditions

    • Apply appropriate normalization techniques to account for technical biases

    • Select differentially expressed genes using statistical methods such as SAM (Significance Analysis for Microarrays) with a 10% FDR threshold

  • Network inference algorithm application:

    • Implement ARACNE (Algorithm for the Reconstruction of Accurate Cellular Networks) to infer regulatory relationships

    • Apply additional algorithms (GENIE3, CLR, TIGRESS) for consensus network building

    • Validate predictions through comparison across methods

  • Network analysis and hypothesis generation:

    • Identify hub genes and master regulators through centrality measures

    • Conduct enrichment analysis of connected gene clusters

    • Generate testable hypotheses about regulatory relationships

When implementing these techniques, researchers should follow these methodological guidelines:

  • Ensure sufficient biological replicates (minimum n=3) for robust statistical analysis

  • Include appropriate time points to capture the dynamics of transcriptional responses

  • Verify that genes within operons show consistent transcriptional responses

  • Integrate metabolic pathway information to interpret network structures

The application of these techniques in related bacterial systems has successfully identified regulators such as OmpR as key controllers of complex transcriptional programs . Similar approaches could reveal previously unknown regulators of respiratory chain components in Buchnera aphidicola, providing insights into the evolution of metabolic regulation in this highly reduced genome.

What are the emerging research trends in studying endosymbiont respiratory components?

The study of respiratory components in endosymbionts like Buchnera aphidicola is evolving rapidly, with several methodological advances and conceptual shifts emerging in recent years. Researchers exploring this field should consider the following trends:

  • Integration of structural biology approaches with functional studies: Cryo-electron microscopy is increasingly being applied to visualize the molecular architecture of respiratory complexes in their native membrane environment, providing insights into how these structures have adapted to the endosymbiotic lifestyle.

  • Single-cell technologies for studying bacteriocyte-specific metabolism: Advanced techniques now allow researchers to isolate individual bacteriocytes and measure metabolic activities at unprecedented resolution, creating opportunities to understand microenvironmental effects on respiratory function.

  • Synthetic biology approaches to reconstitute and manipulate symbiotic systems: Researchers are developing experimental systems that allow for controlled manipulation of endosymbiont genomes, including the introduction of modified respiratory components.

  • Systems-level investigation of metabolic interdependencies: Rather than studying NADH-quinone oxidoreductase in isolation, researchers are increasingly placing it within the context of integrated metabolic networks that span both symbiont and host.

  • Evolutionary experimental studies: Laboratory evolution experiments are being designed to trace the trajectory of adaptation in model symbiotic systems, potentially recapitulating aspects of respiratory chain evolution seen in natural endosymbionts.

The methodological shift toward integrative approaches represents a significant advance over earlier reductionist strategies. Future research will likely continue this trend, with increasing emphasis on understanding how respiratory components contribute to the stability and efficiency of symbiotic relationships across diverse host lineages .

How might future technological advances impact our understanding of Buchnera aphidicola nuoK function?

Future technological advances are poised to dramatically enhance our understanding of NADH-quinone oxidoreductase subunit K (nuoK) function in Buchnera aphidicola through several methodological innovations:

  • CRISPR-based technologies: The continued refinement of CRISPR-Cas systems for manipulation of uncultivable endosymbionts will enable precise genetic modifications of nuoK and related genes in their native context, allowing for functional studies that were previously impossible.

  • Advanced imaging technologies: Developments in super-resolution microscopy and correlative light-electron microscopy will allow visualization of respiratory complexes within bacteriocytes with unprecedented detail, revealing spatial organization and dynamics.

  • Microfluidic systems for ex vivo bacteriocyte maintenance: These systems will allow for controlled manipulation of the microenvironment surrounding bacteriocytes, enabling real-time measurement of respiratory activity in response to changing conditions.

  • Computational prediction of protein-protein interactions: Advances in machine learning approaches for predicting structural interactions will improve our understanding of how nuoK integrates within the complete NADH-quinone oxidoreductase complex and interacts with other cellular components.

  • Long-read sequencing technologies: These will enhance metagenomic analyses by improving assembly of complete endosymbiont genomes from complex samples, facilitating comparative genomic studies across diverse aphid lineages.

The methodological implications of these advances are significant - researchers will need to develop integrated experimental workflows that combine these technologies to address increasingly sophisticated questions about nuoK function. As these approaches mature, we can expect a shift from descriptive studies toward mechanistic understanding of how nuoK contributes to the metabolic integration between Buchnera and its aphid host, potentially revealing novel principles of symbiotic energy metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.