Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Peptidyl-prolyl cis-trans isomerase D (ppiD)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Characterization

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Peptidyl-prolyl cis-trans isomerase D (ppiD) is a genetically engineered protein derived from the obligate aphid endosymbiont Buchnera aphidicola. This enzyme (EC 5.2.1.8) belongs to the rotamase family, catalyzing the isomerization of proline-containing peptide bonds to facilitate proper protein folding . The recombinant form is produced in heterologous systems such as yeast (Saccharomyces cerevisiae) or baculovirus, with partial sequences (e.g., residues 1–292) commonly used for biochemical studies .

Key PropertiesDetails
UniProt IDP57550
Gene NameppiD (BU478)
Molecular FunctionPeptidyl-prolyl cis-trans isomerase activity
Purity>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized: 12 months; liquid: 6 months)
Host SystemsYeast, E. coli, baculovirus, mammalian cells

Biological Role in Buchnera-Aphid Symbiosis

Buchnera aphidicola is essential for aphid survival, providing amino acids absent in their phloem diet . The ppiD enzyme plays a critical role in protein quality control within Buchnera, ensuring proper folding of symbiont-derived proteins necessary for nutrient biosynthesis . Despite extensive genome reduction (~600 kb in B. aphidicola), ppiD is retained across aphid lineages, highlighting its functional importance .

Comparative Genomic Analysis of ppiD in Buchnera Strains

Host Aphid SpeciesSubspeciesUniProt IDGenome SizeProtein Length
Acyrthosiphon pisumsubsp. Acyrthosiphon pisumP57550 ~618 kb Partial (1–292)
Baizongia pistaciaesubsp. Baizongia pistaciaeQ89A98 ~640 kb Partial
Schizaphis graminumsubsp. Schizaphis graminum-~641 kb Partial

Production and Recombinant Applications

Recombinant ppiD is utilized in structural and functional studies to investigate:

  • Protein folding mechanisms under symbiotic conditions .

  • Host-symbiont interactions, particularly in nutrient exchange across the symbiosomal membrane .

  • Thermal stress responses, as Buchnera lacks heat-shock proteins like IbpA in some strains .

Expression Systems Comparison

Host SystemYieldPurityTagApplications
Yeast Moderate>85%Variable (manufacturer-defined)ELISA, enzymatic assays
Baculovirus High>85%UndisclosedStructural studies
E. coli Low>85%His-tag (optional)Antibody production

Stability and Handling Protocols

  • Reconstitution: Lyophilized ppiD is reconstituted in sterile deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Shelf Life: 12 months (lyophilized) vs. 6 months (liquid) at -80°C .

  • Caution: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C retain functionality for ≤1 week .

Evolutionary and Functional Insights

  • Genomic Stasis: ppiD exhibits synteny conservation across Buchnera lineages, reflecting its essential role despite genome reduction .

  • Co-evolution: Codiversification with aphid hosts over 160–280 million years has constrained ppiD sequence variability .

  • Stress Adaptation: In A. pisum, Buchnera ppiD may compensate for lost heat-shock proteins, as seen in ibpA-deficient strains under thermal stress .

Research Implications

The recombinant ppiD serves as a model for studying:

  • Protein folding bottlenecks in intracellular symbionts .

  • Host-dependent metabolic networks, particularly amino acid biosynthesis .

  • Evolutionary trade-offs in genome-reduced bacteria .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ppiD; BU478; Periplasmic chaperone PpiD; Periplasmic folding chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
Target Protein Sequence
MTKYSQARLNSIIVKFILGVIILSLILSTISIYINRDFEKYIATVNGEKISFNLFKKMYFIEREKQKKILGKNFFKFSHNENFTKETYNYVLSQLINNVLLEQYAKNMNYLEVNDNTIKKIIYNSPIFQKNNKFSKERYLNYLTSINSTNHEYINIIKKKINTENLIHTISKSNFILKKEEKNIIKLLSQKRIIKKAIVKIDPSIYKKNITNQEAQIYFKKNQDNFYIPEKFKINFVELKTDNFKIHCENKEIYDWYIRNITQYSTKEKRRYSIIQVKNKQQAISILSRLHNTPEDFSKIAQEQSTDPISSKKDGDIGWISIDLIPDEIKHANLNKKNQISDVIPFHNEFLIVKLNETQIGTQKKIYEVFDSIKKQIKQKKSLDLYNELKNKISNNLKNDPGKIERILKENNILIQETDWFDKKSIPKVLNIPILKQFIFNKKLFQKDTTVKPQFHFIVLKKNQSFLIKIKKFKNKEIQHFENVKKNIIKKLRFIKAIKETKKKSEEIIYDLTQGRKKLFKQSNLYFTDPEIISRYDLSAITSIVFSLPHPQKGKKIYTLYNDKNKNFIIISLEKVYNTNFSEKEKNVILEYLSRHNTEIIFNSILKDLREKSIIKYENIVNK
Uniprot No.

Target Background

Function
This chaperone acts as a gatekeeper on the periplasmic side of the SecYEG translocon. It facilitates the translocation of precursor proteins across SecYEG by interacting with the translocating substrate. Additionally, it plays a role in the release of newly synthesized secreted proteins at the periplasmic exit site of the Sec translocon.
Database Links

KEGG: buc:BU478

STRING: 107806.BU478

Subcellular Location
Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.

Q&A

What is the biological significance of Peptidyl-prolyl cis-trans isomerase D in Buchnera aphidicola?

Peptidyl-prolyl cis-trans isomerase D (ppiD) in Buchnera aphidicola functions as a crucial enzyme involved in protein folding processes, specifically catalyzing the isomerization of peptide bonds at proline residues. This isomerization represents a rate-limiting step in protein folding and is essential for the proper functioning of various cellular processes. In Buchnera, which has undergone significant genome reduction during its evolution as an endosymbiont, each remaining protein holds heightened importance in maintaining cellular function. Based on research with bacterial homologs, ppiD likely associates with the cell membrane and may participate in the folding of outer membrane proteins, potentially contributing to the structural integrity of the Buchnera cells.

The methodological approach to studying ppiD function involves comparative genomics with well-characterized bacterial systems (particularly E. coli, as Buchnera is closely related), proteomic analysis of expression patterns under different environmental conditions, and functional complementation assays. When investigating ppiD function, researchers should consider the challenges of Buchnera's fragile membrane structure, as highlighted in current literature where "Buchnera cell external membrane renders those cells highly vulnerable during the isolation process" and they are "deprived of lipopolysaccharides that makes them easy to brake and/or fuse during the process of grinding the aphid" .

How can I reliably express and purify recombinant Buchnera aphidicola ppiD for functional studies?

Expression and purification of recombinant Buchnera aphidicola ppiD requires careful optimization due to several technical challenges. For reliable expression, the recommended methodological approach includes:

  • Codon optimization of the ppiD gene sequence for the expression host (typically E. coli)

  • Selection of an appropriate expression vector with a strong promoter (T7 or tac) and fusion tags (His6, GST, or MBP) to improve solubility and facilitate purification

  • Transformation into specialized E. coli strains designed for recombinant protein expression (BL21(DE3), Rosetta, or Origami strains)

  • Optimization of induction conditions through systematic evaluation of:

ParameterTest RangeOptimization Goal
IPTG concentration0.1-1.0 mMMaximize yield while minimizing inclusion body formation
Induction temperature15-37°CImprove proper folding; lower temperatures often beneficial
Induction duration3-24 hoursBalance between expression level and protein degradation
Media compositionLB, TB, 2YT, M9Optimize growth conditions for expression host

For purification, implement a multi-step approach beginning with affinity chromatography based on the chosen fusion tag, followed by ion exchange and size exclusion chromatography. Throughout purification, maintain reducing conditions to prevent disulfide bond formation and potential protein aggregation. Activity assays should be performed immediately after purification, as storage conditions may impact enzyme stability and function.

What are the most reliable methods for confirming the identity and activity of recombinant ppiD?

To confirm the identity and activity of recombinant ppiD from Buchnera aphidicola, a comprehensive verification approach is necessary, integrating multiple analytical techniques:

For identity confirmation:

  • SDS-PAGE analysis to verify molecular weight and purity (expect a band at approximately 28-30 kDa)

  • Western blot analysis using antibodies against the fusion tag or, if available, against ppiD itself

  • Mass spectrometry analysis (MALDI-TOF or LC-MS/MS) for peptide mass fingerprinting to unambiguously confirm protein identity

  • N-terminal sequencing to verify the correct start of the protein sequence

For activity verification, implement a peptidyl-prolyl isomerase assay using chromogenic or fluorogenic peptide substrates containing proline residues. The standard methodology employs a coupled chymotrypsin assay where:

  • The substrate (typically Suc-Ala-Phe-Pro-Phe-pNA or similar) exists in both cis and trans conformations

  • Chymotrypsin can only cleave after phenylalanine when the X-Pro bond is in the trans conformation

  • ppiD catalyzes cis-to-trans isomerization

  • The rate of p-nitroaniline release (monitored spectrophotometrically at 390 nm) indicates isomerase activity

Activity measurements should be performed at various protein concentrations to establish enzyme kinetics parameters (Km and kcat). Additionally, testing known PPIase inhibitors (e.g., cyclosporin A, FK506) can provide further confirmation of specific activity.

How can I effectively study the interaction between ppiD and the Buchnera-aphid interface?

Studying ppiD interactions at the Buchnera-aphid interface requires specialized approaches due to the complex nature of this symbiotic system. Rather than attempting to isolate intact Buchnera cells, which is problematic due to their "membranes are deprived of lipopolysaccharides that makes them easy to brake and/or fuse during the process of grinding the aphid" , implement these methodologically sound approaches:

  • In situ localization studies: Utilize immunogold electron microscopy with antibodies against recombinant ppiD to visualize its location within intact bacteriocytes. This approach preserves the symbiotic interface and avoids the cell isolation issues noted in the literature where "the breaking down of this [synaptosomal] membrane weakens Buchnera cells that tend to lyse during the isolation process" .

  • Cross-linking mass spectrometry (XL-MS): Apply protein crosslinkers to intact bacteriocytes followed by mass spectrometry analysis to identify proteins that interact with ppiD. This technique can capture transient interactions and provide spatial constraints for molecular modeling.

  • Yeast two-hybrid or bacterial two-hybrid screening: Using ppiD as bait, screen for interacting proteins from both Buchnera and aphid expression libraries.

  • Co-immunoprecipitation from whole aphid extracts: Using antibodies against recombinant ppiD, pull down potential interaction partners from total aphid extracts without prior Buchnera isolation.

  • Proximity labeling approaches: Express ppiD fused to biotin ligase (BioID) or APEX2 in model systems to identify proximal proteins through biotinylation.

For data analysis, employ quantitative proteomics methods to compare protein interaction networks under different environmental conditions, as environmental challenges have been shown to affect Buchnera density and potentially protein-protein interactions. The proteomic approach has been demonstrated as "the most reliable index for measuring endosymbiont cell density" and can be extended to study protein interactions.

What strategies can overcome the challenges in studying ppiD function in the context of the unculturable Buchnera system?

The inability to culture Buchnera aphidicola independently from its aphid host presents a significant challenge for functional studies of ppiD. To overcome this limitation, implement these methodological strategies:

  • Heterologous expression systems: Express Buchnera ppiD in model organisms like E. coli or yeast, especially in strains with deletions of endogenous ppiD homologs. Complementation assays can reveal functional conservation.

  • In vitro reconstitution systems: Develop artificial membrane systems (liposomes or nanodiscs) incorporating recombinant ppiD to study its membrane-associated functions in a controlled environment.

  • RNAi in aphids: Deliver dsRNA targeting ppiD through artificial diets to reduce ppiD expression in Buchnera. Monitor effects on:

ParameterMeasurement MethodExpected Outcome if ppiD is Functional
Buchnera densityProteomic quantificationPotential reduction in viable Buchnera
Protein folding stressChaperone protein levelsIncreased chaperone expression
Aphid fitnessGrowth and reproduction metricsReduced host fitness
  • CRISPR interference in aphids: Target regulatory elements controlling ppiD expression in Buchnera using modified CRISPR systems delivered through microinjection.

  • Comparative analysis across aphid lines: Leverage natural variation in ppiD sequence or expression levels across different aphid lineages to correlate with phenotypic differences.

For data analysis, integrate multiple measurement approaches, as single metrics like qPCR may be unreliable: "qPCR determination will not approach the cell density but more likely the polyploidy status" . Instead, combine proteomic quantification with functional assays measuring specific aspects of the symbiotic relationship, such as essential amino acid production or stress response.

How can I design experiments to determine if ppiD expression changes in response to environmental stressors?

Environmental stress response studies for Buchnera ppiD require careful experimental design to accurately capture physiological changes in this obligate endosymbiont. Design your experimental approach following these methodological guidelines:

  • Establish appropriate environmental stressors:

    • Temperature variation (heat shock and cold shock)

    • Nutritional stress (amino acid limitation)

    • Oxidative stress (paraquat or hydrogen peroxide exposure)

    • Host immune challenge (peptidoglycan or bacterial infection)

  • Implement controlled exposure protocols:

    • Create replicate populations with precise control of stress intensity and duration

    • Include recovery periods to assess reversibility of responses

    • Establish appropriate controls for each condition

  • Measure ppiD expression using multiple techniques:

    • RT-qPCR for transcript levels (normalized to multiple reference genes)

    • Western blotting for protein levels (normalized to constitutive Buchnera proteins)

    • Mass spectrometry-based targeted proteomics for absolute quantification

When analyzing data, be aware that "Transcriptomic data have shown that Buchnera gene expression changes are confined to a narrow range when the aphids face brutal environmental variations" , suggesting that protein-level changes may be more informative than transcriptional changes. The literature indicates that "our data on the proteome document the very weak relationship between mRNA and proteins levels and that the proteomic approach constitutes the best probe to assess Buchnera cell density" .

Present your findings as fold-changes relative to control conditions, with appropriate statistical analysis accounting for biological replicates. A comprehensive experimental design should include:

Environmental StressorExposure ParametersPrimary MeasurementSecondary Measurements
Heat stress27°C, 32°C, 37°C; 1, 3, 6 hoursProteomic quantification of ppiDTotal Buchnera density, host stress response
Nutritional stressHost plants with varying nitrogen contentppiD protein/transcript ratioAmino acid transport, aphid growth
Oxidative challengeH₂O₂ (0.1-1.0 mM)ppiD localizationMembrane integrity markers

What are the most appropriate controls and normalization methods for quantifying ppiD expression in Buchnera?

The selection of appropriate controls and normalization methods is critical for accurate quantification of ppiD expression in Buchnera aphidicola. Based on the literature, implement these methodological best practices:

For transcript-level measurements:

  • Select multiple, validated reference genes that show stability across experimental conditions (candidates include 16S rRNA, rpoD, and atpD)

  • Employ relative quantification using the 2^(-ΔΔCt) method with correction for primer efficiency

  • Be aware that "qPCR determination will not approach the cell density but more likely the polyploidy status" , as Buchnera cells contain variable numbers of genome copies

For protein-level measurements:

  • Use total aphid protein as a normalization factor, following the approach where "the protein component related to the aphid [is used] as an internal control to normalize the corresponding protein quantity of the endosymbiont"

  • Alternatively, use Buchnera ribosomal proteins as internal controls, as demonstrated in the literature where "ribosomal protein normalization instead of the total aphid spectra number" was employed

  • For western blots, include recombinant ppiD standards at known concentrations to create a calibration curve

The most robust approach employs proteomic analysis, as "the proteomic approach turned out to be an alternative and the most reliable index for measuring endosymbiont cell density" . This method allows researchers to "compare the total protein amount relevant of the endosymbiont in two aphid contexts without preliminary isolation of the cells" , avoiding the technical challenges associated with Buchnera isolation.

For experimental design, include the following controls:

  • Technical replicates (minimum of three) to assess measurement variability

  • Biological replicates (minimum of three independent aphid populations) to account for natural variation

  • Negative controls (samples without Buchnera or with ppiD knockout if available)

  • Positive controls (samples with known ppiD expression levels or spiked with recombinant ppiD)

What machine learning approaches can be applied to analyze complex datasets involving ppiD function and expression?

Machine learning (ML) approaches offer powerful tools for analyzing the complex, multidimensional datasets generated in studies of Buchnera ppiD. Implement these methodological strategies based on recent advances in bioinformatics:

  • Supervised learning for expression pattern recognition:

    • Support Vector Machines (SVMs) can identify patterns distinguishing stress responses from normal conditions

    • Random Forest algorithms can rank features (proteins, transcripts) by their importance in different experimental conditions

    • Gradient boosting methods can predict ppiD expression levels based on environmental variables

  • Unsupervised learning for pattern discovery:

    • Principal Component Analysis (PCA) to reduce dimensionality and visualize relationships between samples

    • Hierarchical clustering to identify proteins with similar expression patterns to ppiD

    • Self-organizing maps to discover coordinated protein networks

  • Deep learning for integrated multi-omics:

    • Convolutional neural networks for analyzing microscopy images of ppiD localization

    • Autoencoders for feature extraction from proteomic datasets

    • Graph neural networks for modeling protein-protein interaction networks

The implementation of ML approaches should follow this workflow:

  • Data preprocessing (normalization, missing value imputation, outlier detection)

  • Feature selection to identify the most informative variables

  • Model training with cross-validation

  • Performance evaluation using appropriate metrics

  • Biological interpretation of model features

For biological validation, experimental approaches similar to those used in other fields can be applied. For example, in equine PPID research, investigators "will use a computer modeling approach known as machine learning to create a new way to diagnose early stages of PPID in affected horses" by teaching "the computer model to identify a specific peptide signature in plasma" . Similarly, machine learning could identify specific peptide signatures associated with ppiD function or expression changes in Buchnera.

How might ppiD function contribute to the stability of the Buchnera-aphid symbiosis under environmental stress?

The potential role of ppiD in maintaining Buchnera-aphid symbiotic stability under environmental stress can be investigated using a systems biology approach. Based on our understanding of protein folding dynamics and bacterial stress responses, ppiD likely contributes to symbiotic stability through several mechanisms:

  • Maintenance of membrane protein integrity: As a peptidyl-prolyl isomerase likely associated with the membrane, ppiD may facilitate proper folding of membrane proteins critical for nutrient exchange between Buchnera and its aphid host. Under stress conditions, this function would help maintain the symbiotic interface.

  • Protein quality control during stress: Environmental stressors can cause protein misfolding. ppiD may work cooperatively with chaperone systems to prevent aggregation and maintain functional proteomes under stress conditions.

  • Regulation of Buchnera density: Research has shown that "the number of the endosymbiont cells can be adjusted in a context of environmental challenge" . ppiD may participate in signaling networks that regulate Buchnera proliferation in response to environmental cues.

To experimentally investigate these hypotheses, implement these methodological approaches:

Research QuestionExperimental ApproachExpected Outcome if Hypothesis is Correct
Does ppiD interact with membrane proteins?Cross-linking followed by mass spectrometryEnrichment of membrane proteins in ppiD interactome
Is ppiD activity modulated by stress?In vitro activity assays under varying pH, temperature, oxidative conditionsAltered kinetic parameters under stress conditions
Does ppiD expression correlate with Buchnera density changes?Time-course experiments monitoring ppiD levels during density changesTemporal relationship between ppiD expression and density shifts

For data analysis, integrate multiple measurement approaches as recommended in the literature where "proteomic wide-scale analysis allowed us to investigate individual protein variations to eventually unmask certain up- or downregulated functional networks" .

Can comparative analysis of ppiD across different Buchnera strains provide insights into host adaptation mechanisms?

Comparative analysis of ppiD across different Buchnera strains associated with diverse aphid hosts offers a powerful approach to understand evolutionary adaptation mechanisms. This methodological framework should include:

  • Sequence-based comparative analysis:

    • Phylogenetic analysis of ppiD sequences from multiple Buchnera strains

    • Identification of positively selected residues using dN/dS ratio analysis

    • Structural modeling to map conserved and variable regions

  • Expression pattern comparison:

    • Quantitative proteomic analysis of ppiD expression across Buchnera strains

    • Comparison of expression responses to standardized stressors

    • Correlation of expression patterns with host ecological niches

  • Functional comparative analysis:

    • Recombinant expression of ppiD variants from different strains

    • Enzymatic characterization (substrate specificity, catalytic efficiency)

    • Complementation assays in model systems

For data integration and interpretation, implement network analysis approaches to identify co-evolving proteins and potentially functionally linked pathways. The comparative approach should explicitly test whether ppiD evolution correlates with:

  • Host plant specialization

  • Geographic distribution and associated climate adaptation

  • Buchnera genome reduction patterns

  • Host aphid phylogeny

Results should be presented as comparative data tables rather than lists, following best practices for scientific reporting . This approach mirrors successful methodologies used in other fields, where researchers have employed comparative analysis to identify "evidence gaps ('uncertainties') and prioritise these into a list of the 10 most important... research questions" .

What implications does recombinant ppiD research have for understanding obligate endosymbiosis in other systems?

Research on recombinant Buchnera aphidicola ppiD has broader implications for understanding obligate endosymbiosis across biological systems. This methodological framework connects specific findings to general principles:

  • Model system development: Buchnera-aphid symbiosis serves as a model for other unculturable endosymbionts. The methodologies developed for recombinant ppiD expression and functional characterization can be adapted for proteins from other endosymbiont systems, such as Wigglesworthia in tsetse flies or Blochmannia in carpenter ants.

  • Evolutionary principles: Comparative analysis of ppiD function across different symbiotic systems can reveal convergent or divergent evolutionary strategies for maintaining endosymbiotic relationships. Look for patterns in:

    • Retention of specific protein folding pathways despite genome reduction

    • Adaptation of enzyme kinetics to host cellular environments

    • Conservation of stress response mechanisms

  • Technical advances: Protocols developed for studying ppiD contribute methodological innovations applicable to other challenging symbiotic systems:

    • Proteomic approaches that avoid isolation challenges

    • Host-symbiont protein interaction analysis methods

    • Normalization strategies for expression studies

  • Translational applications: Understanding fundamental mechanisms of obligate symbiosis has potential applications in:

    • Agricultural pest management strategies targeting symbiotic relationships

    • Probiotic development for managed insect populations

    • Engineering synthetic symbioses for biotechnology applications

When designing research with these broader implications in mind, implement comparative experimental designs that explicitly test principles across multiple systems. For example, extending the proteomic approach that "constitutes the best probe to assess Buchnera cell density" to other endosymbiont systems would validate its utility as a general methodological principle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.