Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
secE; BU040; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
secE
Target Protein Sequence
MNKHHYNRNKHKIPEKVKWISISIFFILSFFINMCFYETQLFIRIFIISCLMLCAIGTMI YTKKGKDILLYIVMSKKEMQKIIWPKYKETLYTTFIVISVTIFISFILWSIDSVIFRLIA FIISLRF
Uniprot No.

Target Background

Function
Essential subunit of the Sec protein translocation channel SecYEG. It clamps the two halves of SecY together and may interact with the channel plug during translocation.
Database Links

KEGG: buc:BU040

STRING: 107806.BU040

Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of SecE conservation in Buchnera aphidicola?

Despite undergoing extensive genome reduction over approximately 200 million years of symbiosis with aphids, Buchnera aphidicola has maintained the secE gene, indicating its essential role in bacterial survival . The preprotein translocase SecE subunit forms a critical component of the Sec translocation machinery, which is necessary for protein transport across the bacterial membrane. The conservation of this gene across different Buchnera strains, including those from Baizongia pistacea and Acyrthosiphon pisum, demonstrates strong selection pressure to maintain protein translocation functions despite genomic stasis and reduction . This conservation persists despite the smaller folding efficiency of proteins in Buchnera compared to free-living bacteria, highlighting SecE's indispensable role in maintaining cellular functions within the host environment .

What role does SecE play in the obligate symbiotic relationship between Buchnera and aphids?

The SecE protein, as part of the Sec translocon complex, plays a critical role in the symbiotic relationship by facilitating the secretion of proteins necessary for nutrient exchange between Buchnera and its aphid host. In obligate endosymbionts like Buchnera, the protein translocation machinery becomes especially crucial for maintaining the metabolic integration with the host organism . Given that Buchnera's primary role in the symbiosis is nutritional supplementation (particularly providing essential amino acids to aphids feeding on phloem sap), proper protein translocation is essential for metabolic pathway functionality .

The conservation of secE gene neighborhoods (transcriptons) between Buchnera and its free-living relative E. coli indicates that selective pressures have acted to maintain transcriptional networks essential for symbiosis . The protein enables Buchnera to secrete enzymes involved in amino acid biosynthesis pathways that benefit the host, while also facilitating the import of host-derived metabolites necessary for bacterial survival in this obligate relationship.

What mechanisms regulate secE gene expression in Buchnera given its reduced regulatory capacity?

Gene regulation in Buchnera has been a subject of scientific controversy, with conflicting evidence regarding its capacity for responsive transcriptional regulation . Research indicates that while Buchnera has lost most specific transcriptional regulators during genome reduction, it retains some general DNA-topological regulators including Nucleoid Associated Proteins and topoisomerases . Analysis of five Buchnera strains from different aphids shows that the relative positioning of regulatory genes along the chromosome has been conserved despite genome erosion.

For secE specifically, regulation likely depends on these general topological regulators rather than specific transcription factors. Sigma-70 promoters with canonical thermodynamic sequence profiles have been detected upstream of approximately 94% of the coding sequences in Buchnera . Based on Stress-Induced Duplex Destabilization (SIDD) measurements, unstable σ70 promoters are particularly associated with regulator and transporter genes, potentially including secE . This suggests that while Buchnera lacks sophisticated regulatory mechanisms, basic expression control through DNA topology and general sigma factors persists for essential genes like secE, allowing minimal but sufficient adaptation to environmental changes within the stable host environment.

How do intrapopulational variations in secE affect protein function in symbiont populations?

Intrapopulational genetic variation is an important aspect of Buchnera biology, with genome sequencing revealing approximately 1,200 polymorphic sites within non-clonal field samples . For the secE gene, such variations could potentially impact protein function and symbiotic effectiveness. The polymorphisms likely represent ongoing mutagenesis within Buchnera populations coupled with relaxed selection in the protective host environment.

Research approaches to study this variation include:

ApproachApplication to SecEExpected Outcome
Deep sequencingAnalyze polymorphism frequency across secE gene regionsIdentification of conserved vs. variable domains
Site-directed mutagenesisExpress variants with specific polymorphismsFunctional impact assessment
Protein structure predictionCompare folding efficiency of variantsEffects on stability and interaction potential
Population genetics analysisTrack polymorphism distribution across aphid coloniesNatural selection patterns on secE variants

How has the reduced chaperone network in Buchnera affected SecE folding and translocon assembly?

The computational analysis of protein folding in Buchnera predicts that its proteins exhibit decreased folding efficiency compared to homologs in free-living bacteria . This characteristic extends to the SecE protein and affects the assembly of the Sec translocon complex. The reduced chaperone network in Buchnera, a consequence of genomic reduction, likely complicates proper folding and assembly of membrane protein complexes.

The Sec translocon typically requires specific chaperones for proper membrane insertion and complex formation. With fewer chaperones available, Buchnera has likely evolved compensatory mechanisms such as:

  • Simplified protein domains that fold more readily without chaperone assistance

  • Co-translational membrane insertion to minimize misfolding risks

  • Increased resilience to minor misfolding through sequence adaptations

  • Potential assistance from host factors that may complement missing bacterial chaperones

The efficiency of translocon assembly in this reduced system represents an evolutionary compromise between functional necessity and genomic minimalism. Research approaches to study this issue would include comparative proteomic analysis between Buchnera and free-living relatives, focusing on membrane fraction enrichment and complex stability analysis.

What are the optimal methods for expressing recombinant Buchnera aphidicola SecE protein for functional studies?

The expression of recombinant Buchnera aphidicola SecE presents several technical challenges due to its membrane protein nature and the specialized biology of this endosymbiont. Based on successful expression of the related SecE from Buchnera aphidicola subsp. Schizaphis graminum , the following methodological approach is recommended:

Expression System Selection:
E. coli remains the preferred expression system, as demonstrated by successful expression of the Schizaphis graminum SecE variant . The BL21(DE3) strain or derivatives optimized for membrane protein expression (C41/C43) are recommended. For particularly difficult constructs, cell-free expression systems may be considered as alternatives.

Vector Design Considerations:

  • Include an N-terminal His-tag for purification purposes, following the successful approach with other Buchnera proteins

  • Consider a fusion partner (such as MBP or SUMO) to enhance solubility

  • Include a precision protease cleavage site between the tag and the target protein

  • Codon optimization may be necessary, adjusting for E. coli preference while preserving critical protein features

Expression Protocol:

  • Transform expression plasmid into selected E. coli strain

  • Culture cells in LB or 2YT medium supplemented with appropriate antibiotics

  • Induce at lower temperatures (16-25°C) to minimize inclusion body formation

  • For membrane proteins like SecE, induction with lower IPTG concentrations (0.1-0.5 mM) is often beneficial

  • Extended expression times (overnight) at reduced temperatures may improve yield

Purification Strategy:

  • Cell lysis via sonication or pressure homogenization in buffer containing detergents suitable for membrane proteins (DDM, LDAO)

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization of membrane proteins using selected detergents

  • IMAC purification using the His-tag

  • Size exclusion chromatography for final purification and buffer exchange

  • Storage in detergent micelles or reconstitution into liposomes or nanodiscs for functional studies

What techniques are most effective for studying SecE interactions with other Sec translocon components?

Understanding the interactions between SecE and other components of the Sec translocon is crucial for elucidating the functional adaptations in this obligate endosymbiont. The following techniques are particularly valuable for studying these protein-protein interactions:

In vitro Reconstitution Approaches:

  • Purify individual components (SecY, SecE, SecG) and reconstitute the complex in detergent micelles or lipid membranes

  • Use analytical ultracentrifugation or size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm complex formation

  • Assess stability using thermal shift assays with varying component ratios

Structural Analysis Methods:

  • Cryo-electron microscopy of reconstituted complexes

  • X-ray crystallography (challenging but potentially feasible with stabilizing antibody fragments)

  • Crosslinking mass spectrometry to map interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in complex formation

Functional Assays:

  • In vitro translocation assays using proteoliposomes containing reconstituted complexes

  • ATPase activity measurements in the presence of SecA and various substrate proteins

  • Fluorescence-based assays to monitor conformational changes during the translocation cycle

Genetic Approaches:

  • Complementation studies in conditional SecE mutants of E. coli

  • Two-hybrid or split-protein complementation assays adapted for membrane proteins

  • Site-directed mutagenesis targeting predicted interaction interfaces

These techniques should be adapted considering the known challenges of Buchnera proteins, such as their reduced folding efficiency and potential dependency on specific lipid environments mimicking the endosymbiont membrane composition.

How can cell-penetrating peptides be utilized for direct protein delivery in studying SecE function in aphid bacteriocytes?

Recent developments in protein delivery to aphids using cell-penetrating peptides (CPPs) offer promising approaches for studying SecE function directly in bacteriocytes . Penetratin (PEN), a widely conserved CPP among insects, has been successfully used to deliver recombinant proteins into various aphid tissues, including bacteriocytes where Buchnera resides .

Design Strategy for SecE Functional Studies:

  • Express recombinant SecE-PEN fusion protein in E. coli, similar to the successful mVenus-PEN approach

  • Add visualization tags (fluorescent proteins) or functional tags (enzymes for activity assays) to monitor localization and function

  • Design control constructs with mutated SecE versions to compare functional consequences

Delivery Protocol:

  • Purify the SecE-PEN fusion protein using affinity chromatography

  • Introduce the protein into adult unwinged Acyrthosiphon pisum females using nanoinjection into the hemolymph, following established protocols

  • Allow 24-48 hours for protein distribution throughout tissues

  • Collect bacteriocytes for analysis via dissection

Analytical Approaches:

  • Confocal microscopy to confirm protein delivery to bacteriocytes

  • Immunolocalization to assess incorporation into Buchnera membranes

  • Functional assays to measure impact on protein translocation (e.g., using reporter substrates)

  • Transcriptomic or proteomic analysis to identify system-wide effects of modified SecE function

This method offers several advantages for SecE functional studies:

  • Avoids the challenges of genetic manipulation in the obligate symbiont Buchnera

  • Allows direct observation in the native host environment

  • Enables time-controlled studies through timed delivery of proteins

  • Permits comparative studies across different aphid species harboring different Buchnera strains

How should researchers interpret contradictory results between in vitro and in vivo studies of SecE function?

When studying SecE function in Buchnera aphidicola, researchers often encounter discrepancies between in vitro reconstitution experiments and observations in the natural symbiotic context. These contradictions stem from several factors specific to obligate endosymbionts:

Common Sources of Contradictions:

FactorIn Vitro ImpactIn Vivo RealityMitigation Strategy
Protein folding efficiencyMay appear fully functionalReduced efficiency in Buchnera Include chaperones in in vitro systems
Membrane compositionStandard phospholipids usedSpecialized composition in bacteriocytesUse extracted Buchnera membranes or mimic composition
Interaction partnersLimited to selected componentsComplete native interactome presentExpand reconstitution complexity gradually
Post-translational modificationsOften absentMay be present in natural systemMass spectrometry analysis to identify modifications

To properly interpret contradictory results, researchers should:

  • Consider the genomic context and gene neighborhood conservation of secE, which indicates preserved transcriptional units (transcriptons) that may influence expression patterns

  • Evaluate results in light of Buchnera's reduced regulatory capabilities, which limit adaptive responses

  • Assess whether observed functions are consistent with the metabolic integration between Buchnera and its host

  • Validate findings through complementary approaches, particularly those utilizing cell-penetrating peptides for direct delivery to bacteriocytes

Understanding these contradictions provides valuable insights into the adaptations of essential cellular machinery to endosymbiotic life and the compromises between functional necessity and genomic reduction.

What are the most common technical challenges in working with recombinant Buchnera SecE and how can they be overcome?

Working with recombinant Buchnera SecE presents several technical challenges that researchers should anticipate and address:

Challenge 1: Low Expression Yields

  • Cause: Buchnera proteins are adapted to the specialized intracellular environment and may contain features that limit expression in heterologous systems.

  • Solution: Optimize codon usage for the expression host, reduce cultivation temperature (16-20°C), use specialized strains like C41/C43, and consider fusion partners like SUMO or MBP to enhance solubility.

Challenge 2: Membrane Protein Solubilization

  • Cause: SecE is an integral membrane protein with hydrophobic domains that complicate extraction and purification.

  • Solution: Screen multiple detergents (starting with mild options like DDM, LMNG, or LDAO), optimize detergent:protein ratios, and consider nanodiscs or SMALPs for maintaining a more native lipid environment.

Challenge 3: Protein Instability

  • Cause: Reduced folding efficiency characteristic of Buchnera proteins leads to stability issues during purification and storage.

  • Solution: Include stabilizing agents (glycerol 10-20%, specific lipids), avoid freeze-thaw cycles by storing at 4°C for short-term use , and utilize thermal shift assays to identify optimal buffer conditions.

Challenge 4: Functional Reconstitution

  • Cause: SecE functions as part of a multi-protein complex that is difficult to reconstitute in vitro.

  • Solution: Co-express with partner proteins (SecY, SecG), purify as a complex rather than individual components, and validate complex formation using size exclusion chromatography or native PAGE.

Challenge 5: Limited Reference Data

  • Cause: Few studies specifically characterize Buchnera SecE compared to model organisms.

  • Solution: Utilize comparative approaches with better-characterized homologs from E. coli, leverage structural predictions based on conserved domains, and design experiments that relate structural features to functional outputs.

Implementing these strategies will significantly improve success rates when working with this challenging but scientifically valuable protein from an obligate endosymbiont.

How might comparative studies across Buchnera strains from different aphid species advance our understanding of SecE evolution?

Comparative analysis of SecE across different Buchnera strains provides a unique opportunity to study protein evolution in the context of reductive genome evolution and host co-adaptation. Buchnera strains from different aphid species (including Acyrthosiphon pisum, Schizaphis graminum, Baizongia pistacea, and Cinara species) represent different stages and trajectories of endosymbiont evolution .

Promising Research Approaches:

  • Sequence-Function Relationship Mapping:

    • Compare SecE sequences across strains with different genome sizes

    • Correlate sequence variations with host specialization and metabolic capabilities

    • Identify differentially conserved domains suggesting host-specific adaptations

  • Compensatory Evolution Analysis:

    • Examine co-evolution between SecE and other Sec translocon components

    • Identify compensatory mutations that maintain function despite accumulating deleterious changes

    • Map intragenic compensatory changes within the SecE protein itself

  • Experimental Validation Through Domain Swapping:

    • Create chimeric SecE proteins with domains from different Buchnera strains

    • Test functionality in reconstituted systems or via CPP-mediated delivery

    • Identify functionally critical regions versus those with greater evolutionary flexibility

This comparative approach could reveal how essential cellular machinery adapts to the distinctive pressures of endosymbiotic life while maintaining core functionality, potentially uncovering novel mechanisms of protein complex stabilization in minimalist genomes.

What potential applications might emerge from understanding the specialized adaptations of SecE in Buchnera?

The study of Buchnera SecE adaptations has potential applications that extend beyond fundamental understanding of symbiosis to practical biotechnological applications:

Minimal Protein Secretion Systems:

  • Insights from the streamlined but functional Buchnera Sec translocon could inform the design of minimal protein secretion systems for synthetic biology applications

  • Identification of essential components versus dispensable features could guide the creation of simplified protein export machinery for specialized cell factories

Protein Evolution Engineering:

  • Understanding how SecE maintains function despite reduced folding efficiency could provide design principles for engineering proteins with enhanced stability under suboptimal conditions

  • Compensatory mechanisms identified in Buchnera proteins could inform directed evolution strategies for protein engineering

Novel Antimicrobial Approaches:

  • The essential nature of protein translocation combined with the distinctive features of endosymbiont SecE might reveal targets for disrupting pathogenic bacteria while minimizing impacts on beneficial microbes

  • Comparative analysis between Buchnera and pathogen protein secretion systems could highlight exploitable differences

Enhanced Protein Delivery Systems:

  • Combining knowledge of Buchnera SecE with cell-penetrating peptide technology could lead to improved methods for delivering therapeutic proteins to specific tissues

  • The natural adaptations for functioning in specialized intracellular environments might inform the design of synthetic delivery vehicles

These applications represent the translation of fundamental research on this specialized bacterial protein into solutions for biotechnology, medicine, and agricultural challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.