Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BU275)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable Intracellular Septation Protein A (BU275)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable Intracellular Septation Protein A (BU275) is a bacterially derived protein produced via recombinant DNA technology. It is a full-length protein (1–177 amino acids) from the obligate endosymbiont Buchnera aphidicola, which resides in aphids and plays a critical role in their nutrition by synthesizing essential amino acids . BU275 is annotated as a probable intracellular septation protein, potentially involved in cell division or membrane organization . This recombinant variant is expressed in E. coli with an N-terminal His tag for purification and research applications .

Key Features

PropertyDetails
UniProt IDP57363
Gene NameBU275
SynonymsInner membrane-spanning protein YciB, yciB
Source OrganismBuchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length (1–177 amino acids)
Amino Acid SequenceMKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); store at -20°C/-80°C

Functional Context

BU275 is part of the reductive genome of Buchnera aphidicola, which has lost ~70% of ancestral genes but retains conserved pathways critical for symbiosis . Despite its annotation as a septation protein, its precise role in Buchnera cell division remains unconfirmed experimentally. Computational analyses suggest it may contribute to membrane-associated processes .

Genomic and Evolutionary Insights

  • Genome Conservation: BU275 is retained in all sequenced Buchnera strains, including those from Acyrthosiphon pisum, Schizaphis graminum, and Baizongia pistaciae, indicating evolutionary importance .

  • Gene Order Stability: BU275 resides in a genomic region with near-perfect synteny across Buchnera lineages, suggesting functional constraint despite extensive genome reduction .

  • Proteomic Detection: In a large-scale proteomic study of the aphid-Buchnera symbiosis, BU275 was identified in Buchnera-enriched fractions, confirming its expression in vivo .

Hypothesized Functional Partnerships

While BU275’s direct interactors are uncharacterized, Buchnera’s metabolic network relies on host-encoded enzymes (e.g., BCAT, GOT2) to complete essential amino acid biosynthesis . BU275’s membrane localization suggests potential involvement in metabolite transport or symbiosome membrane dynamics, though experimental validation is needed .

Current Uses

  • Structural Studies: BU275’s recombinant form enables biophysical analyses (e.g., crystallization, NMR) to resolve its 3D structure .

  • Antibody Production: Used as an antigen for generating antibodies to study Buchnera cell biology .

  • Symbiosis Mechanistics: Investigates host-symbiont interactions, particularly membrane protein dynamics during nutrient exchange .

Technical Challenges

  • Instability: Repeated freeze-thaw cycles degrade the protein; glycerol (50%) is recommended for long-term storage .

  • Low Yield: Buchnera’s uncultivability necessitates recombinant expression, which often produces limited quantities .

Future Directions

  • Functional Knockdown: CRISPR/Cas9-mediated gene editing in aphids could clarify BU275’s role in Buchnera persistence .

  • Interactome Mapping: Identification of BU275-binding partners in Buchnera or aphid bacteriocytes .

  • Comparative Genomics: Assess BU275 orthologs in other insect endosymbionts to infer conserved mechanistic roles .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BU275; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
BU275
Target Protein Sequence
MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: buc:BU275

STRING: 107806.BU275

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.